GenomeNet

>vch:VC1456 K10929 cholera enterotoxin subunit B | (RefSeq) cholera enterotoxin subunit B (A)
MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAI
ITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAI
SMAN

BLAST