KEGG   Acidovorax avenae: Acav_2019Help
Entry
Acav_2019         CDS       T01445                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aaa  Acidovorax avenae
Pathway
aaa00010  Glycolysis / Gluconeogenesis
aaa00071  Fatty acid degradation
aaa00350  Tyrosine metabolism
aaa00625  Chloroalkane and chloroalkene degradation
aaa00626  Naphthalene degradation
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
aaa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acav_2019
  Lipid metabolism
   00071 Fatty acid degradation
    Acav_2019
  Amino acid metabolism
   00350 Tyrosine metabolism
    Acav_2019
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Acav_2019
   00626 Naphthalene degradation
    Acav_2019
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Acav_2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 TrkA_N 2-Hacid_dh_C adh_short
Motif
Other DBs
NCBI-ProteinID: ADX45933
JGI: Acav_2019
UniProt: F0Q902
LinkDB All DBs
Position
complement(2255687..2256721)
Genome map
AA seq 344 aa AA seqDB search
MLPKTMKAAVVREFGKPLTIEEAPVPTPADDQILVKIEASGVCHTDLHAAEGDWPVKPNP
PFIPGHEGVGFVAAIGRNVKHVKEGDRVGVPWLHSACGCCTHCLGGWETLCESQSNTGYS
VNGGFADYALADPNFVGHLPKDVGFVDIAPVLCAGVTVYKGLKVTDTKPGDWVVISGIGG
LGHMAVQYAKAMGLNVAAVDVEDDKLELAKKLGASVTVNAKTTDPAAYLQKEIGGAHGAL
VTAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLPIFDMVLRGVTVRGSIVGTRLDLQES
LDFAARGQVKATVATEKLENINDVFARMHKGQIQGRIVLDMAAH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccaagaccatgaaagccgccgtcgtgcgcgaattcggcaagcccctcaccatc
gaggaagccccggtaccgacgcccgccgatgaccagatcctcgtgaagatcgaggcctcc
ggcgtctgccacaccgacctgcacgccgccgaaggcgactggcccgtcaagcccaacccg
ccgttcattcccggccacgagggcgtgggtttcgtcgcggccatcggcaggaacgtgaag
cacgtgaaggaaggcgaccgcgtgggcgtgccgtggctgcattcggcctgcggctgctgc
acccactgcctgggcggctgggaaaccctgtgcgaatcgcagagcaacaccggctattcg
gtcaacggcggtttcgccgactacgcgctggccgaccccaacttcgtgggccacctgccc
aaggacgtcggcttcgtggacatcgctcccgtgctgtgcgcgggcgtgaccgtgtacaag
ggcctgaaggtgacggacaccaagccgggcgactgggtggtcatctccggcatcggcggc
ctgggccacatggccgtgcagtacgccaaggccatgggcctgaacgtggcggccgtggac
gtggaagacgacaagctcgaactggcgaaaaaactcggcgccagcgtgacggtgaacgcg
aagaccaccgacccggccgcctatctgcaaaaggagatcggcggcgcccatggcgcgctg
gtcacggccgtctcgcccaaggccttcgagcaggcgctgggcatggtgcgccgcggcggc
accgtgtcgctcaacggcctgccgcccggcaacttcccgctgcccatcttcgacatggtg
ctgcgcggcgtcaccgtgcgcggctccatcgtcggcacgcgcctggacctgcaggaatcg
ctggacttcgcggcccgcggccaggtcaaggccaccgtggcgaccgagaagctggagaac
atcaacgacgtgttcgcgcgcatgcacaagggccagatccagggccgcatcgtgctggac
atggcggcccactga

DBGET integrated database retrieval system