KEGG   Acidovorax avenae: Acav_3650Help
Entry
Acav_3650         CDS       T01445                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4152577..4157934)
Genome map
AA seq 1785 aa AA seqDB search
MNAKDLALSAALGAEAAAPRNFVERLRTLADERPDAVWLTVVDEPQGGRREVALTYAEFA
RRVHALAARLQQRFAPGERALVLQDNDEHYAASMLACFHSGIVAVPVFPPESQRPQHLAR
LQGIARDCGAACVLTTTEWEAMVRAGFPGLEVIAGDAVDLALAGTWRTHEPADDDLAFLQ
YTSGSTGHPKGVMVTHGNLMANERAIQEGMATGPEDCFVSWAPLFHDMGLIGGLLQPLYC
GASLVLVSPRYFLERPARWLELVSRYRGTVSGGPDFSYRLCLERISDAQAQGLDLSHWRV
AYSGAEPVRADTMAAFAERFAAQGFRAGAVHACYGLAEATLYVTGVRPGQGLWARGFSAQ
ALAVGAAEPDDAGTGPLLVGCGGPASGHAVQIMDVASLAPADAGCVGEVWASGPSVAAGY
WGQPEATAATFVEHGGRRWLRTGDLGFLHEGQLVVTGRTKDLIILRGHNVYPQDVERAIE
AEVEAVRKGRVAVFPVQGAQAEGIGAAVEVSRGMQKLVPPQALVEALSAAVSEAVGEPLS
VVLLLQPGTLPKTTSGKLQRSACRAAWVERSADAYAIHEWGRFVRGGPQEAAASGGGALD
ALESEVAGIWQDVLRAAAPQALDRNSHFFVLGGNSLAATQAAARIAQRFGVAFAPRVLFD
HPRLGACVEALRAAMAVAPAGSAGAGAVASAVEPLPPALRGGNRPLSHAQARQWFLWKLA
PAEAAYHVGAALWIEGEFDAAAAQAALEDVARRQASLRTVFGEGPDGVPFQRVEEMPAIA
LEVADLGRTACSERDDAVRERLDALQSRPFDLLQGPPWRVALLRLDARTHVLAVVMHHIL
SDGASMQLWAAEWLEAYGARRQGLAARGMPQLQYIDYAAWTAGRLEAGEGERQWAWWRER
LADWHATPCEVRPDHPRPPRASYTARRHAFEVPAAVVQGLRALQAREGATSFIVLLAALQ
VLLSRYTGQPRVRVGAAVAQRGVPGVDGLIGLFVNTLVLPGAVGPQATLLGVLRDAREMV
LGAQAHQELPFDRLVEALRPERSAGASPLFQVMLNHLAEDDRLLQAVPGLAVRAEPLQGP
QAQFELVLEARERGTGALSLTWVYAGELFEPATIERLSGHFLALMQAMAEGPEQPAGAVE
WLAPAERAQLDAWSRNGHRESPPVPVFRQLEAHAERQPQATALLFGDEAIGYGALNARAN
RLAHHLLREGLRPQSLVGICMQRSTEMIVGMLAAMKAGCAYLPLDPELPAGRLGDMLEHS
GAAWVLSHAATAGQVPALPGVRVIGVEGLQNAVPGDAENPGIAVHGEQLAYVIYTSGSTG
RPKGVAVRHAALHTCMAWMQGTYGLTASDTVLHKAPFGFDVSCWEIFWPLTAGARLLVAP
PGAHRDPEHIVQLIERHQVTTLNFVPSMLRAFLDHPGIEHRTRLRHVICGGEAMPETLQR
EALRRLPGATLQNLYGPTETTIHVTRWTCRDEAGPVPIGRPISETQAWVLDAQLQPVPQG
VAGELYIGGALLARGYLGQPGLTAERFVADPQGAGGRLYRTGDWVRWNAEGQIEYLGRID
HQVKLRGLRIELGEIESALRAQAGVKDAVAVVRGAAGAESLVAYVAGEGDAVALRAALAQ
RLPGYMVPRAIVVLDALPLNANGKVDRAALPDPEPAAGTGNGEPAAPQGSTAHRLAALWS
ELLGVPSVGLQDNFFDLGGHSLLLVRAHRRLEDEWGCRLALVDLFQHPTVESLARRIDQA
TGESEGEGGPAHSGASAAPHLADDRARRQRAALLQRRAHLQGARE
NT seq 5358 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgaaggatcttgcactgtccgccgccctgggcgcggaggcggcggcgccgcgc
aatttcgtcgagcggctgcgcacgctggccgatgagcggccggacgctgtctggctgacg
gtggtggacgagccgcagggcggccggcgcgaagtggcgctgacctacgcggagttcgcg
cgccgcgtgcacgccctggccgcgcggctgcaacagcggttcgccccgggcgagcgcgcg
ctggtgctgcaggacaacgacgagcactatgccgccagcatgctggcgtgctttcacagc
ggcatcgtcgcggtgccggtgtttccgccggaatcgcagcggccccagcacctggcgcgg
ctgcagggcatcgcgcgggactgcggcgcggcctgcgtgctgaccacgacggagtgggag
gcgatggtgcgcgccggcttccccggcctggaggtgatcgcgggcgatgcggtggacctg
gcgctcgccggcacctggcgcacgcacgaaccggcggacgacgacctggctttcctgcag
tacacgtccggctccacggggcatcccaagggcgtgatggtgacacacggcaacctgatg
gccaacgagcgcgccatccaggaaggcatggcaacggggcccgaggactgcttcgtctcg
tgggcgccgctgttccacgacatgggcctgatcgggggactgctgcagccgctctattgc
ggggcatccctggtgctggtatcgccgcgctatttcctggagcggcccgcgcgctggctg
gagctggtgtcgcgctaccgcggcacggtcagcggcgggcccgacttctcgtaccgcctc
tgcctggagcgcatcagcgacgcgcaggcgcaggggctggacctgtcgcactggcgcgtg
gcctacagcggggcggagcccgtgcgggccgacaccatggcggccttcgccgaacgcttc
gcggcccagggtttccgcgcaggcgcggtgcatgcctgctacggcctggccgaggcgacg
ctgtacgtgaccggtgtgcgccccgggcagggcctgtgggcgcggggcttttccgcgcag
gcgctggccgtgggcgcggcggaaccggacgatgcgggcacggggccgctgctggtgggc
tgcggtggcccggcgagcgggcatgccgtgcagatcatggacgtggcatcgctcgccccc
gccgacgcgggctgcgtgggggaggtctgggcgagcgggcccagcgtggcggcgggctac
tggggccagccggaggcgacggccgccaccttcgtggagcatggcggccggcgctggctg
cgcacgggcgacctgggcttcctgcatgaggggcaattggtcgtgaccgggcgcaccaag
gacctgatcatcctgcgcggccacaacgtctatccacaggacgtggagcgggccatcgaa
gccgaggtggaggcggtgcgcaagggccgcgtggccgtgttcccggtgcagggggcgcag
gccgaaggcatcggcgcggcggtggaggtgtcgcgcggcatgcagaagctcgtgccgccg
caggcgctggtggaggccctgagcgcggccgtgagcgaggcggtgggcgagccgctgtcg
gtcgtgctgctgctgcagcccggcacgctgcccaagaccaccagcggcaagttgcagcgc
agcgcctgccgcgcggcctgggtggagcgcagcgccgatgcctacgccatccacgagtgg
gggcgcttcgtgcgcggcgggccgcaggaggccgccgcgtccggcggcggcgccctggat
gcgctcgaatccgaggtggcgggcatctggcaggacgtgctgcgcgccgcggcgccgcag
gcgctggaccgcaactcgcatttctttgtgctgggcggcaattcgctcgcggccacccag
gcggcggcgcgcattgcgcaacgcttcggcgtggcgttcgcgccgcgcgtgctgttcgac
catccgcggctcggtgcttgcgtggaggccctgcgcgcggccatggccgtggcgcccgcg
ggcagcgccggcgccggtgcggtcgcgagcgccgtggagccgctgcccccggccctgcgc
ggcgggaaccgtccgctgtcgcatgcccaggcgcgccagtggttcctctggaagctggcg
cccgcggaggccgcctaccacgtgggcgcggcgctgtggatcgaaggggagttcgatgcc
gctgcggcccaggccgcgctggaggacgtggcgcggcggcaggcgtcgctgcgcaccgtg
ttcggcgaaggcccggatggcgtgccgttccagcgcgtggaggagatgccggccatcgcg
ctcgaggtggcggacctgggccgcaccgcctgctcggagcgcgacgatgccgtgcgcgag
cggctggacgcactgcagtcccggcccttcgacctgctgcagggcccgccgtggcgggtg
gcgctgctgcgcctggatgcgcgcacgcacgtgctcgccgtggtgatgcaccacatcctc
tcggacggcgcatcgatgcagctctgggccgccgagtggctggaggcctatggcgcgcgc
cgccagggcctggccgcgcggggcatgccgcagctgcagtacatcgattacgcggcctgg
accgccggccggctggaagccggcgagggcgagcggcagtgggcctggtggcgggagcgg
ctggccgattggcacgcgacgccctgcgaggtacgtccggaccatccgcgcccgccgcgc
gcgtcctacaccgcacgccgccatgccttcgaggtgccggcggcggtggtgcagggcctg
cgcgcgctgcaggcgcgcgagggcgcgacctccttcattgtgctgctggcggccttgcag
gtgctgctgtcccggtacacgggccagccgcgcgtgcgcgtcggcgcggcggtggcgcag
cggggcgtgcccggcgtggacgggctgatcggccttttcgtgaacaccctggtgctgccg
ggcgcggtggggccccaggccacgctgctcggcgtgctgcgcgacgcgcgggagatggtg
cttggggcccaggcccaccaggagctgcctttcgaccggctggtggaggccctgcggccg
gagcgcagcgcgggcgcgagcccgctgttccaggtcatgctcaaccacctggcggaagac
gatcggctgttgcaggcggtgccggggctcgccgtgcgggccgagccgctgcaggggccg
caggcgcagttcgaactggtgctggaggcgcgcgagcgcggcaccggggcgctgtcgctc
acctgggtgtatgcgggcgagctgttcgagcctgccaccatcgagcggctgtccggccat
ttcctggccctgatgcaggcgatggccgagggcccggagcagccggcgggcgcggtggag
tggcttgcgcccgccgagcgcgcgcagctggacgcatggagccgcaacggccaccgcgag
agcccgcccgtgcccgtcttccggcagctggaggcgcatgccgagcgccagccgcaggcc
acggcgctgctgttcggcgatgaggccatcggctacggggcgttgaacgcgcgggccaac
cgcctcgcgcaccacctgctgcgcgaggggttgcggccgcagtcgctggtgggcatctgc
atgcagcgctcgaccgaaatgatcgtgggcatgctggcggcgatgaaggcgggatgcgcc
tacctgccgctggaccccgagctgccggccgggcggctgggcgacatgctggagcacagc
ggcgcagcctgggtgctgtcgcatgcggcgacggccgggcaggtgcccgcgctgccgggc
gtgcgggtgatcggcgtggaaggactgcagaacgcagtgcccggcgatgcggagaacccc
ggcatcgcggtgcatggcgagcaactcgcctatgtcatctacacctcgggttccacgggg
cggcccaagggcgtggccgtgcgccatgcggcgctgcacacctgcatggcctggatgcag
ggcacctacgggctgaccgcgtcggacacggtgctgcacaaggcgcccttcggtttcgac
gtgtcgtgctgggaaatcttctggccgctcacggccggcgcccgcctgctggtggcgccg
ccgggggcgcaccgcgatccggagcacatcgtgcagttgatcgagcgccaccaggtcacc
acgctgaacttcgtgccgtccatgctgcgggccttcctggaccatccgggcatcgagcac
cgcacccgcttgcggcatgtgatctgcgggggcgaggcgatgcccgagaccctgcagcgc
gaggccctgcggcgcctgccgggtgccacgctgcagaacctctatgggcccacggaaacg
acgatccatgtcacccgctggacctgccgcgacgaggccgggcccgtgcccatcgggcgg
cccatcagcgaaacgcaggcctgggtgctcgatgcgcagctgcagccggtgccccagggc
gtggccggcgagctttacatcggcggggccctgctggcgcgcggctacctgggccagccg
gggctgactgccgagcgcttcgtggccgatccgcaaggggcgggcgggcgcctgtaccgc
accggggactgggtgcgctggaatgccgaagggcagatcgaatacctggggcgcatcgac
caccaggtgaagctgcgcggcctgcggatcgagctgggcgagatcgagtcggcgctgcgc
gcgcaggccggcgtgaaggacgcggtggccgtggtgcgcggcgcagcgggtgccgagtcg
ctcgtagcctacgtggcgggcgagggagacgccgtggcgctgcgcgcggcgctggcgcag
cggctgcccggctacatggtgccgcgcgccatcgtggtgctggatgcgctgccgctcaat
gccaatggcaaggtggaccgggccgcgctgcccgatcccgagcctgcagcgggcaccggc
aacggcgagcccgcagccccgcagggcagcacggcgcaccggctggcggcgctgtggagc
gagctgctgggcgtgccgtcggtgggcctgcaggacaacttcttcgacctgggcggccac
tcgctgctgctggtgcgtgcccaccgccggctggaggacgagtggggttgccggctcgcg
ctggtggacctgttccagcaccccacggtggaatcgctcgcgcgccgcatcgaccaggcc
acgggtgagagcgaaggcgagggcggcccggcgcattccggcgcttccgccgcgccacac
cttgccgacgaccgcgcgcgccggcagcgggctgcgctgctgcagcgccgcgcccatctc
caaggagcccgggaatga

DBGET integrated database retrieval system