KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0979Help
Entry
Aaci_0979         CDS       T00985                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Brite
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Aaci_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1052414..1053028)
Genome map
AA seq 204 aa AA seqDB search
MPHQLPPLPYAYDALEPHIDAATMNVHYNGHHAAYVNNLNKALEGHPDLESKTVEQLISN
LDAVPENIRTAVRNNGGGHANHSLFWPLLSPNGGGEPTGKLADAIRETFGSFEAFKEQFT
QVATARFGSGWAWLVLDNGKLALMSTANQDNPLMEGKKPILGLDVWEHAYYLKYQNRRPE
YIKAWWNVVNWDQANKNYEAALNG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccacatcaactcccaccgcttccctacgcgtatgacgcgctggaaccccacatcgac
gcggcgaccatgaacgttcactacaatggccaccacgcggcgtacgtcaacaacctgaac
aaggcgctcgagggccatccggatcttgaatccaagaccgtggaacagctcatcagcaac
ctggatgccgttccggagaatatccgcaccgcggttcgcaacaacggcggcggtcacgcc
aaccacagcctgttctggccgctcctttcgccgaacggcggcggcgagccgaccggcaag
ctggcggacgccatccgggagacgttcggtagctttgaggcgttcaaggagcagttcacg
caggtcgccacggctcgcttcggaagcggctgggcttggctcgtcctcgacaacggcaag
ctcgctttgatgagcacggcgaaccaggacaatccgctcatggagggcaagaagcccatc
ctcggcctcgacgtatgggagcacgcgtactacctcaagtatcaaaaccgccgtccggaa
tacatcaaggcctggtggaacgtcgtgaactgggatcaggccaacaagaactacgaggcc
gcgctgaacggctga

DBGET integrated database retrieval system