KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2136Help
Entry
Aaci_2136         CDS       T00985                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aaci_2136
  Energy metabolism
   00680 Methane metabolism
    Aaci_2136
Enzymes [BR:aac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Aaci_2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2193883..2196603)
Genome map
AA seq 906 aa AA seqDB search
MANDAPLHRDIRVLGDLLGEVLVEQCGRRVFDHVESIRLAAKAFRADPSPETRAALQAAV
SAVEPEHRNDVIHAFSVYFQLVNLAEQNHRLRRHRDYDRSQQVLRGSFRETMRTLADRGM
TADDIESLLREVGIELVLTAHPTEALRRTVLDKHTKIAAFLEDMDDPRKTPRELDVLRER
IRTEIVALWQTRSVRKQRITVLDEVRNGLYFLDQILFDVLPRVHQKLEQAVEEQFGRQLL
ELPPLIRFGSWMGGDRDGNPNVTSDITWQTLVLHCDLALNKYEQKLRELGRDLSVSVDRA
GADEDLLASLGGENDEPYRALINRMLERLANTRRRLHGERVDGPDYASPEAMMEDVERMA
RSLAHHRGQRMVDAWLRPFLLQLRIFGFHMVTLDIRQHSGVHEQAVAELLQTAGLVDDYT
SLGEEERVRVLSECLASPRPIRNPYHVYSDVTTEALAVLDCVRRGHETFGPRCVQDYLIS
MTQGASDLLEVLLLAKESGLFGWPDGPMAPPKSDLNVVPLFETIEDLESAAGIMRSLFEN
PVYRRHLEMRGWQQEIMLGYSDSNKDGGYLTANWSLYMAQKHLIRLAEAYGVRIKFFHGR
GGALGRGGGPVEQSILAQPTEALRGHVKITEQGEVISQRYGHPGIAERSLESSAAAVLVG
ATREDSEEWAERHPRWFRLLDRASEISFRAYRKLVFEHPAFLEYFHRATPIDEIGKMNIG
SRPSRRSQSARIEDLRAIPWVFSWTQSRHLLPAWYGFGSAIEAIMREDPRALEDLRRMYE
VWPFFRTLVDNLQMALAKADMLVAKEYAQLAGEAGEAVFPLIEEEYARTERAVLDITGYR
QLLDNRPVIRESISLRNPYVDPLSFFQVRLLADLRTDNLSPEEREAELADALQTINGIAA
GLRNTG
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaacgacgcacccttgcaccgggacatacgcgtcctcggggatttgttgggagaa
gtgctggtcgagcagtgcggccggcgcgtcttcgatcacgtcgaatccattcgcctcgct
gccaaggcctttcgcgcggacccgtcgcccgaaacgcgcgcggcgctgcaggcggccgtg
tccgccgtggagcccgagcaccggaacgacgtgattcacgcgttttcggtctactttcag
ttggtcaacctcgcggagcaaaaccacaggcttcgccgccaccgagattacgatcgctcg
caacaggtgctgcgcgggtcgtttcgcgaaaccatgcgcaccctggccgatcgcggcatg
accgccgacgacattgagtccctgcttcgggaggtcgggatcgagctcgtgctcaccgcg
catcccaccgaggcgctgcgccgcaccgtgctcgacaaacacacgaagatcgcggctttc
ctcgaggacatggacgatccgcgcaagacgccgagagagctcgacgtgctgcgcgagcga
attcgcaccgagatcgtcgcgctgtggcaaacgagatcggtgcgcaagcagcgcatcacc
gtgctggatgaggtccgaaacgggctgtactttctggaccagatcctgttcgacgtcctt
cctcgcgtgcatcaaaagctcgaacaggcggtcgaggaacagtttggtcgtcagcttctc
gaactgcccccgcttattcgcttcggctcgtggatggggggcgatcgcgacggcaatccg
aacgtcacgtccgacatcacctggcagacgctcgtcctccactgcgatctcgccctcaac
aaatatgagcaaaagttgcgagaactcgggcgcgatctgagcgtgtccgtggaccgggcg
ggcgcggacgaggatctcctggcttccctgggaggcgaaaacgacgagccgtaccgggcg
ctcatcaaccggatgctggagcggctcgccaacacgcggcgccggctgcacggggagcgg
gtggacggtcccgattacgcgtcacccgaagcgatgatggaggacgtcgaacggatggcg
agatcgctcgcgcatcaccggggccagcgcatggtggatgcgtggttgcgcccgttcctg
ctgcagcttcgcatcttcggcttccacatggtgacgctcgacatccgtcagcactccggc
gttcatgagcaggcggtggcggagctcttgcagacggcgggcctcgtggacgactacacg
tcgcttggcgaggaagagcgcgtgcgcgtcctgtccgaatgccttgcgtcgccgcgcccc
attcgcaatccgtatcacgtgtactccgatgtcaccacggaggcgctcgcggtcctcgac
tgcgtgcggcgagggcacgagaccttcgggcctcgctgcgtgcaggactacctcatttcc
atgacgcaaggcgcgagcgacctgcttgaggtgttgctcttggcgaaggagtccggcttg
ttcggctggccggacgggccgatggcgccgcccaagagcgacttgaacgtcgttccgctg
tttgagaccatcgaggacctggagtccgcggcggggatcatgcggtcgctgtttgaaaac
cccgtgtatcggcgtcacctggagatgcgcggctggcagcaggagatcatgctcgggtat
tccgacagcaacaaggacggcggctatctcaccgccaactggtcgctgtacatggctcaa
aagcacctgattcgcctggcggaagcgtacggcgtgcgcatcaagttctttcacggccgg
ggcggcgcgctggggcgagggggcggtcccgtggagcagagcattctcgcccagcccacg
gaggcgctccgagggcacgtgaagatcacggagcagggcgaggtcatctcgcagcggtat
ggacacccgggcatcgccgaacgctcgcttgagtcctcggcggcggctgtgctggtgggc
gccacgcgagaggacagcgaggagtgggcagagcgccatccgaggtggtttcggcttttg
gaccgagcgtcggaaatcagcttccgcgcctaccggaagctggtcttcgagcatcccgcg
ttcctcgagtatttccatcgggcgacgcccattgacgagatcggcaagatgaacattggg
tcgaggccttcgcggcgctcgcagtcggcgcgaatcgaggacctgcgggccatcccctgg
gtgttctcgtggacgcagagccgccacctgctgcccgcctggtacggcttcggcagtgcg
atagaggccatcatgcgggaggaccctcgcgcgcttgaagaccttcgccgcatgtacgag
gtgtggccgttcttccggacgctggtcgacaatcttcagatggcgctcgccaaggcggat
atgctcgtggcgaaggaatacgcgcagttggcgggggaggcgggagaggccgtctttccg
ctgattgaggaggagtacgcgcgcacggagcgcgccgtgctcgacatcacgggctaccgg
cagcttctcgacaacaggccggtcatacgggagtccatctcgcttcgcaacccgtatgtc
gatccgctgtcgttcttccaggtgcgcctgttggccgatctgcgcacggacaacctgtcg
cccgaagagcgcgaggcggagctggccgacgcgctgcagaccattaacggcatcgccgcg
ggcctgcgcaataccggctga

DBGET integrated database retrieval system