KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2348Help
Entry
Aaci_2348         CDS       T00985                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00020  Citrate cycle (TCA cycle)
aac00480  Glutathione metabolism
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
aac01130  Biosynthesis of antibiotics
aac01200  Carbon metabolism
aac01210  2-Oxocarboxylic acid metabolism
aac01230  Biosynthesis of amino acids
Module
aac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aac_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aaci_2348
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Aaci_2348
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Aaci_2348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACV59355
UniProt: C8WRU4
LinkDB All DBs
Position
complement(2412056..2413354)
Genome map
AA seq 432 aa AA seqDB search
MPTFERYQLPTEGEPITLVDGKLNVPDHPIIPFIEGDGTGPDIWRAAQRVFDAAVEKAYG
GKRKIAWYEVYAGEKAYNMFGEWLPQDTLTALSEYIVSIKGPLTTPVGGGIRSLNVAVRQ
ELDLYVCQRPVRYFQGVPSPVKHPELVDMVIFRENSEDIYAGIEWQAGTPEVKKVIEFLQ
KEMGVKKIRFPETSGIGVKPVSREGTERLVRAAIEYALRHKRKSVTLVHKGNIMKFTEGA
FKNWGYELAEREFSDKVFTWAQYDRIKAEKGQEAADAAQKEAIEAGKLIVKDVIADAFLQ
QILTRPAEYDVIATLNLNGDYISDALAAQVGGIGIAPGANINYETGHAVFEATHGTAPKY
AGLDKVNPGSVILSGVMMFEYMGWQEAADLITRAMEKTIAQKIVTYDFARLMEGATEVKC
SEFGDHIIQNMG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgtttgagagatatcaactgccaacggagggcgaacccatcacgttggttgac
gggaagttgaacgtaccggatcacccaattattccgtttatcgaaggagacggcacagga
ccggacatctggcgcgctgcgcagcgggtgttcgacgccgccgtcgagaaggcctacggc
ggaaagcgcaagatcgcctggtacgaggtgtatgcgggtgagaaggcgtacaacatgttt
ggcgaatggctgccgcaggatacgctgaccgcgctgtcggaatatatcgtcagcatcaag
ggtcccttgaccacaccggtgggaggcggcatccgctcgctgaacgtggcggttcgccag
gagttggacctctacgtctgccagcgccccgtgcgttacttccagggcgttccttcgccg
gtgaaacatcctgaactcgtggacatggtgatcttccgcgaaaactcggaggacatctac
gccgggatcgagtggcaggcgggtacgccggaggtcaagaaggtcatcgagtttctccag
aaggagatgggcgtcaagaagatccgcttcccggagacgtccggcatcggcgtgaagccc
gtctcgcgcgagggcacggagcgcttggtgcgcgccgcgattgagtatgccctgcgccac
aagcgcaagagcgtcacgctcgtccacaagggcaacatcatgaagttcaccgagggcgcg
ttcaagaactggggctacgagctggctgagcgcgagttctcggacaaggtattcacctgg
gcgcagtacgatcgcatcaaggccgagaagggccaggaggctgcggacgcggcgcagaag
gaggccatcgaggccgggaagctcatcgtgaaggacgtgatcgccgacgccttcctgcag
cagatcctgacgcgtccggccgagtacgacgtcattgcgacgctcaacctgaatggcgac
tacatctcggacgcgctcgccgcacaggtcggcggcattggcattgcgccaggcgccaac
attaactatgaaacggggcacgcggtcttcgaggcgacgcacggcacggcgcccaagtac
gcggggctcgacaaggtgaacccgggctcggtgattctctcgggcgtcatgatgttcgag
tacatgggttggcaggaggctgccgatctcatcacccgcgcgatggagaagaccattgcg
cagaagatcgtgacgtacgacttcgcccgcttgatggagggcgcgaccgaggtgaagtgc
tccgagttcggcgatcacatcattcaaaatatgggctga

DBGET integrated database retrieval system