KEGG   Acetobacter aceti: A0U92_01500Help
Entry
A0U92_01500       CDS       T04735                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
aace  Acetobacter aceti
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aace00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A0U92_01500
   00650 Butanoate metabolism
    A0U92_01500
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A0U92_01500
   00280 Valine, leucine and isoleucine degradation
    A0U92_01500
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A0U92_01500
Enzymes [BR:aace01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A0U92_01500
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     A0U92_01500
Amino acid related enzymes [BR:aace01007]
 Aminotransferase (transaminase)
  Class III
   A0U92_01500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
325929..327209
Genome map
AA seq 426 aa AA seqDB search
MSTGKSNKDLSARRAAAVPVGVGSATAIYAERALGAELWDVEGRRYIDFAAGIAVVNVGH
RHPAVIQAVQEQLEHFSHTGFQVAPYENYVALAERLNAAAPFDGPAKSIFFTTGAEATEN
AVKIARAATGRSGVIAFTGGFHGRTLLASAMTGKVNPYKTQFGTMPGDVFHVPFPAQGVS
VADSLNALDLMLAADVDPSRVAAIIIEPIQGEGGFRVSSKELLEGLRERCTKHGILLIAD
EVQTGFARTGKLFGIQHSGVQPDLISVAKALGGGFPLSGVVGRAEIMDAVRPGGLGGTYG
GSPLACAAGLAVLDVIEKENLCARAESLGETISKRIAGWTERSDLIAVGKAHGLGAMIGF
DVLSAHGSDEVQAGGAASICARAAEAGLIVLSCGVLGETVRLLPPLTISDELLQEGLDLL
EASLKN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacaggcaagagcaacaaggatctgtcggctcggcgtgcggcagccgttcctgtt
ggtgtcggttcggcgaccgctatttatgcggagcgggctctgggtgccgaactgtgggat
gtcgaaggacgtcgctacattgattttgcagcgggaatcgctgtggtcaatgtcggtcat
cgtcatccggctgtcattcaggctgtgcaggaacaactcgagcatttcagtcatacgggc
tttcaggtcgcgccgtatgaaaactatgttgctctggcagaacgtctgaacgccgccgcg
ccgttcgatggtccggcaaaaagcattttcttcacgaccggtgctgaagcgacagagaat
gcggtgaaaatcgcccgggctgcgacaggccggtcaggcgttatcgcgtttaccggtggc
ttccatgggcgcacgctgcttgcgtctgccatgaccggcaaggtgaacccttacaagaca
cagttcggcaccatgccgggtgacgtctttcatgtgccgttccctgcgcagggtgtgtcg
gttgcggatagcctcaatgcgcttgatctgatgcttgctgcggacgttgatccgtcccgt
gtggctgcgatcatcattgagccgatccagggtgaaggcggtttccgcgtgagttcgaag
gagcttctggaaggcctccgcgaacgatgcacgaagcatggcatcctgttgattgctgat
gaggttcagaccggctttgcccgtactggcaaactgttcggcatacagcattcaggtgtt
cagcctgatctgatctcggtcgcgaaagctcttggtggcggattcccgctgtctggcgtt
gttggccgtgcagagatcatggatgcggtccgtccgggtggtctcggcggaacatatggc
ggctcaccacttgcctgtgcagcgggtcttgcagttcttgatgtcatcgaaaaagagaat
ctttgcgcccgcgcagagagtcttggtgagacaatcagcaagcgcattgccggttggacg
gaacgtagcgatctgatcgctgtaggcaaggctcatgggcttggcgccatgattggcttc
gatgtcctcagcgctcatggttctgacgaagtgcaggccggaggtgcggcgtcaatctgc
gcacgcgcggcagaggcaggcctgatcgtgttgtcttgtggtgttctgggagagacggtg
cgtctcctgccgcctttgaccatcagtgatgaactgttgcaggaaggtctggatcttctt
gaggcatccctcaagaactga

DBGET integrated database retrieval system