KEGG   Acetobacter aceti: A0U92_02070Help
Entry
A0U92_02070       CDS       T04735                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aace  Acetobacter aceti
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aace00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A0U92_02070
  Energy metabolism
   00680 Methane metabolism
    A0U92_02070
Enzymes [BR:aace01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A0U92_02070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
464743..467655
Genome map
AA seq 970 aa AA seqDB search
MAAASSSSGSPLIAGGDALSAGARAILAMGHFHESEGETQNPPPAEVTGNDVLSTAWRVS
TLLEQGKASLVDLQAVIRHLRDDAFLRRATRLHRYPGGTSSSVTEDRLKGVVRQVLDSAF
GRTNGTEGSDGDEVTEPTRPTAAEALARFRAELERTRYAAVFTAHPTFAVANEVYAALAS
YASAPGPQDTAPDLLSHRRTAAPTLEEEFSLASAAILRGRDALDRLNVELLGASRETWPD
AWSSIIPRPVIMTSWVGYDTDGRTDIGWWDTLRLRLKMKLFQLQRLRQQIMESGVEASTL
TSRLSRACYTVEAQIAACPKNADADATVEFATLIVDHKEDAILDPAVLGDALQDVIDTAS
PDAALAVAVARAGFFAHGMSASHSHTRLNATQLHNVIRQRLRFTDDPADPAHRRALLAHI
NEALENVSPVPVDFGALLVEQASAAKLMMTVAQIVKHIDSATLVRFLIAETESGYTLLAA
LWLAKHFGIDDKVEISPLFETREALMGGAHIIEEALRSPHWRDYLRKTGRLCLQFGYSDS
GRYVGQLAATYLIERLRLKILDLLHVWDLEDVEVVLFDTHGESVGRGGHPFRLSDRFAYL
SPMHVRAKFAERGVKYREESAFQGGDGYLLFGTPELAAASVATIAEHTFEPVRRHDDPVY
DEPDFSSDFFSTIADAMTGLVADPGYADVLGAFGPSLIDKTGSRPAARQSEGGGATPRIT
HPSQLRAIPNNAILQQLGWCANTIQGLGSAARRHPETFETFREGSARFRRALDFAAHALA
HSDDQVLRSVIWLLDPGYWLDRATAEPRSGKRERYLTVMHDLERLDFWADTQSMFRRIQE
DHLALRAVWPEAPTIHPAEKLLHAIRIALIEKIWVLATQIPFFMPRGNFTRDVMMRRILC
LEIPSVLRELDAIFPRGGTKLDYNFHEPAGPQVDNSYSQEHDEIFQPMQEMFQMMREISV
ALMHGIGAFG
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcgtcctcgtcctccggttctccgctgattgccggaggcgatgctctttct
gccggagcccgcgccattctggcgatgggacattttcatgagagcgaaggcgagacgcag
aacccgccccctgcggaggtgaccggtaatgacgtcctgtcgacagcatggcgggtttcc
acgctgctggagcagggtaaggcgtcgcttgtggatttgcaggcggttatcaggcatctg
cgtgacgatgctttcctgcggcgtgcgacacgattgcatcgctatccgggaggcaccagt
tcttccgtcaccgaagaccgcctgaaaggcgtggtgcggcaggttctggactcggcattt
ggccggacgaacggtaccgaagggtctgacggggacgaagtgacggaacccacacgcccc
acggctgcggaggcgctcgcccgttttcgggctgagctggaacgcacccggtatgcggcg
gtttttacggcgcatccgacttttgctgtcgcaaatgaagtgtacgcggcgctcgccagc
tatgcctctgctccggggcctcaggataccgcgccagatctgctttcccatcgtcggacg
gcggcgcccacgcttgaggaagagttttcactcgcctcggcggctatcctgcgggggcgg
gatgcgctcgacaggctgaatgtggaactgctcggcgcgtcgcgtgaaacctggccggac
gcctggtcttccatcattcctcgtccggtcatcatgacaagctgggtcggttatgacacg
gacggccgcacggatatcggctggtgggacacgctccgcctgcgcctgaagatgaaactg
ttccagttgcagaggcttcggcagcagattatggagtccggtgtggaagcgtccacattg
acaagccgcctgtcgcgcgcctgttacacggttgaggcccagatcgcggcctgtccgaag
aatgctgatgcagatgcgacagtggaattcgccactctcatcgtggaccacaaggaagac
gccattctcgatcctgcggtgctgggtgatgcgcttcaggatgtcatcgacacggcttcg
ccggacgccgctcttgcggtggcagtcgcccgcgctggcttcttcgcgcacggcatgtcg
gcctctcacagccatacgcgcctgaacgccacgcagcttcataacgtaatccgccagcgc
ctccgtttcacggatgatccggctgatccggcccatcgccgcgctctgctggcccatatc
aacgaggcgctggaaaacgtctcgcccgtgccggtggattttggcgcgttgctggtggag
caggcttccgccgccaagctgatgatgacggtcgcccagatcgtcaagcatatcgattcg
gcaacactggtgcgcttcctgatcgccgagacggagagcggttacaccctgctggcggct
ctctggctcgcgaagcatttcgggatcgacgataaggtcgagatttctccgctgttcgaa
acgcgcgaagccctgatgggtggggcgcatatcattgaagaggcgctgcgttctcctcac
tggcgggactatctccgcaagaccgggcggctctgtctccagttcggctattccgattcc
ggccgttatgtcggacaactcgccgcgacctatctgattgaacgcctgcgcctgaagatc
cttgatctgctgcatgtctgggatctggaagatgtcgaggtcgtgctgttcgacacgcac
ggcgaaagcgtcggacgaggcggccatccgttccgtctgtctgaccggttcgcctatctg
tcgcccatgcatgtacgggcgaagttcgctgaacgcggcgtgaaataccgcgaggaaagc
gcctttcagggcggtgacggctatctgctgttcggcacgccggaactggcggcggcgagt
gtcgccaccatcgcggagcacacgttcgagcccgtccgtcgccatgacgatccggtctat
gacgagcctgatttttcctcggatttcttctccacgatcgctgatgcgatgaccggtctg
gtcgcggaccccggttacgccgatgtgctcggggcgtttggcccgtccctgatcgacaag
accggctcacgtccggcggcacggcagagtgaaggtggcggggcgactcctcgcatcacg
catccaagtcagctccgggccattccgaacaacgccattctccagcagcttggctggtgc
gctaacaccattcagggactgggatctgcggctcggcgtcatccggagactttcgagacc
ttccgggaaggcagcgcccgcttccgtcgggcgcttgacttcgccgcgcacgcgctggcg
cattcggacgatcaggtgctgcgcagcgtgatctggctgcttgacccgggctactggctg
gaccgggcgaccgccgaaccccgctccggcaagcgtgagcgctatctcacggtgatgcat
gatctggagcggctggatttctgggcggacacgcagtccatgttccgtcggattcaggag
gatcatctggcattgcgggcggtctggccggaggctccgaccattcatccggctgaaaag
cttctgcacgccatccgcatcgccctgattgaaaagatctgggtgctggcgacccagatc
ccgtttttcatgccgcggggaaatttcacccgtgatgtgatgatgcggcggattctctgt
ctggaaataccgtctgtgctgcgtgaactggatgccattttcccgcggggcggcaccaag
ctggattacaatttccacgaaccggccggaccgcaggtggataattcctacagtcaggaa
catgacgagattttccagcctatgcaggagatgttccagatgatgcgcgaaatcagcgtg
gcgctcatgcacgggattggcgcgttcggctga

DBGET integrated database retrieval system