KEGG   Aureococcus anophagefferens: AURANDRAFT_59085Help
Entry
AURANDRAFT_59085  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aaf  Aureococcus anophagefferens
Pathway
aaf04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aaf00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AURANDRAFT_59085
Enzymes [BR:aaf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AURANDRAFT_59085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-GeneID: 20222726
NCBI-ProteinID: XP_009037702
JGI: Auran1_59085
UniProt: F0YBC5
LinkDB All DBs
Position
Unknown
AA seq 222 aa AA seqDB search
MPARRPRSTARAVALRSGARTKFTLPALSYDYGALEPVISGQIMEIHHSKHHNTYVTNLN
AAVETLEQATAAGDVTAIVAAQGAIKFNGGGHLNHSIFWENLAPPSEGGGAPPTGALAAA
IDAEFGGVDAMKTKLSAMTVGVQGSGWGWLGYNKATGKLALATCPNQDPLEATTGLVPLF
GIDVWEHAYYLDYKNVRPDYVSAIWGLANWADVGARYDAASK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcccgccgcccgcgcagcaccgcgcgcgccgtcgcgctgcgctccggcgcgcgc
acgaagttcacgctgccggcgctgtcctacgactacggcgccctcgagcccgtcatcagc
ggccagatcatggagatccaccacagcaagcaccacaacacctacgtgacgaacctcaac
gcggccgtcgagacgctcgagcaggcgacggccgcgggcgacgtcacggccatcgtcgcg
gcgcagggcgcgatcaagttcaacggcggcggccacctcaaccactccatcttctgggag
aacctcgcgccgccctccgagggcggcggcgcgccgccgacgggcgcgctcgccgcggcg
atcgacgcggagttcggcggcgtcgacgcgatgaagacgaagctctcggccatgaccgtc
ggcgtccagggcagcggctggggctggctcggctacaacaaggccacgggcaagctcgcg
ctcgcgacgtgcccgaaccaggaccccctcgaggcgacgaccgggctcgtgcccctcttc
ggcatcgacgtctgggagcacgcgtactacctcgactacaagaacgtccggcccgactac
gtctccgccatctggggcctcgcgaactgggccgacgtcggcgcccgctacgacgccgcg
tccaagtga

DBGET integrated database retrieval system