KEGG   Aedes aegypti (yellow fever mosquito): 23687505Help
Entry
23687505          CDS       T01053                                 

Definition
(RefSeq) pyrimidodiazepine synthase
  KO
K00310  
pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glutathione metabolism
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    23687505
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    23687505
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     23687505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 257 aa AA seqDB search
MSNGKHLAKGSTPPVLGNDGKLRLYSMRFCPYAQRVHLILDAKNIPYHTIYINLSEKPEW
YFDKNPLGKVPALEVPGKENITLYESLVVADYIEEAYTDKQRKLYPSDPFKKAQDRILIE
RFNGAVISPYYRILFSSESIPPGAITEFGTGLDIFETELKTRGTPYYGGDKPGMLDYMIW
PWCERVDLLKFALGDKYELDKQRFGKLLQWRDLMEKDDAVQKSFLSTENHTKFLQSRKSG
ENNYDILSNNAKKLRVG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacggaaaacatctggccaaaggatccaccccaccggtattgggaaatgacggg
aaactccgcctgtactcgatgcgcttctgtccgtatgcccaacgggtccatctaattttg
gacgcgaagaatataccctatcacactatctacatcaacctaagcgagaaaccggaatgg
tactttgataagaatccactaggaaaagtcccagccttagaagttcccggaaaggaaaac
atcaccctttatgaatccctggttgtggccgactatatcgaggaagcttatacggacaag
caaagaaagctttacccaagtgatccgtttaagaaggcgcaagaccggattcttattgaa
cgcttcaacggagcagttatttcaccttactaccgaattctgttctctagcgaaagcatc
cctccaggtgcaattaccgagtttggaaccgggttagatattttcgagacagaactcaaa
acccgtggcactccgtactatggcggtgacaaaccaggaatgttggattacatgatctgg
ccgtggtgtgagcgcgtagatttgctgaagttcgctcttggggataagtacgaacttgat
aaacagagatttggtaaactgttgcaatggcgtgatttgatggaaaaggatgatgcggtg
cagaaatcattcctttcaacagagaaccatacaaaatttttgcagagcaggaaatctggc
gagaataactacgacattctatcgaacaacgccaaaaagctgcgcgtaggctaa

DBGET integrated database retrieval system