KEGG   Aedes aegypti (yellow fever mosquito): 5568333Help
Entry
5568333           CDS       T01053                                 

Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     5568333
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5568333
Messenger RNA biogenesis [BR:aag03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     5568333
Membrane trafficking [BR:aag04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    5568333
Chromosome and associated proteins [BR:aag03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     5568333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 5568333
NCBI-ProteinID: XP_021694948
LinkDB All DBs
Position
1
AA seq 1115 aa AA seqDB search
MSSTVVTRRGAQKAKISTRAQQAAEAAEASERRNKFYGRRPNPISLAEAKKRGKLKMEGS
ALGPDQAGVQLKDIYSNAMSSMELVRGETGLVYDERFAEHRCLWDEGYPECPERFTRVLE
RCRELGLVDRCKMIEPRMATEEEILTKHTPEQVEILRETKGSEDLERLEELSSHYDAVFV
HPSSYDCSLLACGSTIELVDAVVGGRVQNGMAIIRPPGHHAMKAEYNGYCFFNNVAIAAQ
HALDRLGLKKILVVDWDIHHGQGTQRMFYDDPRVLYFSIHRYECGKFWPNLRESDFDYVG
EGAGLGYNFNVPLNRIGMTNGDYLAIWQQILLPVAMEFQPELVLISAGYDAAYGCPEGQM
EITPAFYPHLLTPLMSLAQGRVAVILEGGYCLSSLAEGGALTLRTLLGDPCPLLVEKLQP
PCESMQQTILNCIHTHRPFWKNLQLNDTYGLEELNNVNPQPNFHQVIQYYVQPEPQPEPV
RYETRNCYPLQSTEEKARIEERLAMLQIATRLTFPANRVCFVYDESLLEHRNVHEDHPEQ
PDRIAKIYTRHEEYKLLARMKRLKPRHATTTELCMVHSRQHVNVIRRTVEREEMKQVADQ
FNSVYFHPKTFECATLAAGSVLQVVDEVLNGQSRSGVCIVRPPGHHAESDMPHGFCIFNN
VAIAAQYAIRDHGLKRVLIVDWDVHHGNGTQHIFESDPRVLYISVHRYDNGTFFPKSTDA
NFDVVGSGSGEGFNVNIPWNKKGMGDQEYSAAFQQIILPVAYEFDPELVLVSAGFDAAIG
DPLGGCKVTPEAYGFFTHWLSSLANGRIVVCLEGGYNVNSISHAMALCTKSLLGDPLPML
HLSSRYNGPNAACVETLRNVLSVQEKFWKSLRFNKKLPDFSNISGAEPDLNGAFSRMRLS
TSATESSGSSSGSPSSAGSSPVKGKDESDVPCDGDEQPGPSRKRKTEDPVEAGPSAGRSS
TGEKHETLRDFLAANLEALQNEEMFAVVPLRDCPHLKELNPENIPEAISTKSPCTGCDSA
IENWVCLHCFRVHCGRYINEHAMLHSVEADHALALSFSDLSVWCYKCESYIDNPVLYAYK
NLVHRDKFDGEELVWSYGSDLFLDVAKPKPGKTKE
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaccgtcgtcaccagaagaggtgcccagaaggccaaaatcagcaccagagcc
cagcaggcagcggaagcggcagaagccagcgagcgaaggaacaaattctacggccgccga
ccgaatccaattagcttggccgaagcgaagaagagggggaagctgaaaatggaaggatcg
gcactgggtccggatcaggccggagtgcagctgaaggacatctacagtaatgccatgtcc
tcgatggaactggtccgtggcgagacggggctggtttatgacgagagatttgccgagcat
cgttgcctgtgggatgaagggtatccggagtgtccggagaggtttacccgggtgctggaa
cgttgtcgggagttggggctggtcgatagatgtaagatgattgagccgaggatggctacg
gaggaggaaatcctcacgaagcatacgccggaacaggtcgagattctgagagagacgaag
ggaagcgaggatctggaacggttggaggagcttagttcgcattacgacgcggtttttgtg
cacccgtcttcgtacgattgttcgctgctggcttgcgggagcacgatcgagctggtagat
gctgtcgtgggcggtcgggtgcagaacgggatggcgattattcgaccgcccgggcatcac
gcaatgaaggccgagtacaatgggtactgtttcttcaacaatgtggccattgctgcccag
catgcgctggatcggttggggctgaagaagatcctggtggtggactgggacatccaccac
ggacagggaacgcagcggatgttctacgatgatccgagagtactgtacttttcgattcat
cggtacgagtgcggcaagttctggccgaatctgcgggaatcggactttgactacgtcgga
gaaggagcgggattgggctacaacttcaatgtgccgctcaaccggatcgggatgacgaac
ggggattatctggccatttggcagcagattctgctgcccgtggcaatggagtttcaaccg
gaattagtgctgatttccgccggttacgacgcagcgtacggctgcccagagggacaaatg
gagatcaccccggccttctacccgcatcttctaactccgctgatgtctctcgctcagggg
cgtgtcgctgtcatcctggaaggtggttattgcctgtcatccttagccgagggcggtgcc
ctcaccttgcggacactcctcggcgatccttgcccactactggtagaaaagctgcaacct
ccatgcgaaagcatgcagcaaaccatcctgaactgtatccacacccaccgacccttctgg
aagaatctccagctgaacgacacgtacggtctcgaggagctgaacaatgtcaatccgcag
ccaaacttccaccaagtgatccaatactacgtccaaccggaacctcaacccgaacccgtc
cgctacgaaacccgcaactgttatccccttcaaagcaccgaagagaaagcccgtatcgag
gaacgtctggccatgctccagattgccactcgtcttacattccctgcgaaccgcgtctgc
ttcgtgtacgatgagtcgctcctggagcaccggaacgtccacgaagatcacccggaacaa
ccggatcggatcgccaagatctacacccgccacgaagagtacaaactgctggcccggatg
aagcgcctcaagccgcgacatgcgaccaccaccgaactgtgcatggttcactcgcggcag
cacgtcaacgtgatccggaggaccgtcgaacgagaggagatgaagcaggtggcggaccag
ttcaactcggtctacttccacccgaagacgtttgaatgtgccacgttggcggctggttcc
gtcctgcaggtcgttgacgaagtgttgaacggtcaatcgagaagcggagtgtgcatcgtt
cgaccccctggccatcacgccgaatccgacatgccgcatggattctgcatcttcaacaat
gttgccatcgcggcgcagtacgccattcgtgatcacggcttgaaacgggtgctgatcgta
gattgggacgtccaccacggaaatggcacgcagcatatcttcgagagtgatcccagggta
ttgtacatttcggttcatcggtatgacaacgggacgttcttcccgaagagtaccgatgcg
aacttcgacgtagttgggtccggatcgggtgagggcttcaacgtgaacatcccttggaac
aaaaagggcatgggagaccaggaatattcggcggccttccagcagatcatcctgccagtg
gcgtacgaattcgacccggagttggtgctagtatcagctggatttgatgcggccatcggg
gatccgctaggtggatgcaaagtcactcccgaagcgtacggattctttacccattggcta
tcttcgctggccaacggtcgaatagtggtttgtctggaaggaggctacaacgtgaactcg
atctcgcatgccatggcgttgtgcacgaaatcactccttggagacccactgccaatgcta
cacctgagttctcgatacaacggaccaaacgctgcctgcgtggaaactttgcgaaacgta
ttgtcagtgcaggagaagttctggaagtcgttgcggttcaacaagaagcttccggacttc
agcaacatctccggtgcggaaccggacctgaatggtgccttcagcagaatgcgtctgtcg
acgtcggccacagaatcttccggcagtagtagtggatcgccttcgtcggcgggatcctca
ccggtgaagggaaaggacgaaagcgacgtcccgtgtgatggcgatgaacaacccggccca
agccggaaaaggaaaacggaggacccggtggaggctggaccaagcgcgggacggtccagc
accggagaaaagcacgaaacgctcagggatttcttggctgccaatctagaggccttacag
aacgaggagatgtttgctgtcgttcccttgcgggactgtccgcatcttaaagaactcaac
ccggagaatattcccgaagccatcagtacaaaatccccttgcaccgggtgcgactccgcg
atagagaactgggtctgtctgcactgcttccgggtgcactgtggtcgctacatcaacgag
cacgccatgctgcacagcgtggaggcggaccacgctctggccctcagcttcagcgacctc
tcggtgtggtgctacaagtgcgagtcctacatcgacaatccggtgctgtacgcgtacaaa
aacctggtccatcgggacaaattcgacggcgaagagctggtatggtcctacgggagcgac
ctgttcctggacgtggccaaacccaagcccggcaagaccaaggaatga

DBGET integrated database retrieval system