KEGG   Aedes aegypti (yellow fever mosquito): 5570644Help
Entry
5570644           CDS       T01053                                 

Definition
(RefSeq) alpha-amylase A
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00500  Starch and sucrose metabolism
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    5570644
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     5570644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 5570644
NCBI-ProteinID: XP_001653283
UniProt: Q16YR0
LinkDB All DBs
Position
1
AA seq 495 aa AA seqDB search
MKLSACFLLSIVTLVRAQFDTHQWSNRSGIVHLFEWKWKDIAEECERFLAPKGYAGVQVS
PPTENSIVKDPNRPWWERYQPISYKLETRSGAEQQFADMVRRCNAVGVRIYVDLVINHMA
ATTVSGGTEGSTGNSDAKQYPAVPYGCDDFHEPCSINDYNDAMQVRNCQLVGLPDLNQTI
QWVQDRIVDLMNSLVDYGVAGFRVDAVKHMWPADLKVIYGKVKNLNSSHGFPSGARPFIS
QEVIDLGGEAISRDEYTDLGVVTEFRYSVEIGRAFHGNNKLKWLSGWGPAWGFMPSEVAL
VFVDNHDNQRGHGPGGSNVLTYKSSKHYKMANAFMLGHPYGIPRIMSSFAFDSSDQGPPQ
DEQGNIISPSINVDGSCGNGWICEHRWRQIYNMIGFRNAVAGTQINDWWDNGNQQISFCR
GGKGFIAFNLDTYDFNRETQTCLPNGTYCDVISGSIVNGTCTGKRIAVNSSGYAKIHIPV
TAEDGVLAIHINAKI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatcagcttgctttttactgagcattgtgacactagtgcgtgcgcaatttgac
acacatcagtggagtaatcgtagtggaatagtgcaccttttcgagtggaaatggaaagac
atcgcagaagagtgcgaaagatttttggcacccaaaggttatgcaggagttcaagtgtca
ccccctacagaaaactcgatcgtaaaggatcccaatcgaccatggtgggagcgataccag
ccaatttcttacaaattagagactcgttcgggagcagaacaacagtttgctgatatggtg
cgtcgatgcaatgctgtaggagtgagaatatatgttgatttggttattaatcacatggct
gcaacgactgtctctggaggaacagaaggttccaccggaaactcagatgcgaagcaatat
ccagctgttccctatggatgtgacgattttcatgagccttgttctatcaatgattacaac
gacgctatgcaagtaagaaattgtcagctagttggactaccggatctgaatcaaacaatt
caatgggtacaagatagaattgtggacttgatgaatagtttagtggattatggagttgca
ggatttagagtggatgcagtcaaacatatgtggccagctgacttaaaagtgatttatgga
aaagtcaagaatctcaactctagtcatggttttccatctggtgctcgaccgttcatttcc
caagaggtaatcgacctgggaggggaagcgatttcacgtgatgagtacactgatctagga
gtcgtcactgagtttcgatactcagtggagattggtcgcgcatttcacggaaacaacaaa
ttgaagtggttaagcggatggggaccagcttggggatttatgccttccgaagtggcgctt
gtatttgttgacaatcacgataaccaaagaggccatggtcctggaggaagcaatgttctt
acatacaaaagctcaaaacattataagatggcaaacgcatttatgttgggccatccttat
ggaataccacgtataatgagttcatttgcatttgattcctcagatcagggacctccccag
gatgaacaagggaacattatatcaccatcaattaacgtagatggtagttgtgggaatgga
tggatttgcgaacaccgttggcgacagatttacaacatgataggttttcggaatgcagtc
gctggtactcagataaatgattggtgggataacggaaaccagcagatatcattctgccgt
ggagggaaaggatttattgcattcaacttggatacctacgactttaatcgcgagacgcag
acatgtcttccaaatggaacttattgtgatgttatctctggaagcatagtgaatggaacc
tgcacaggcaaaagaattgctgttaattcatccggttatgcaaaaatccatattccagtt
actgctgaagatggtgtactcgcgatacacataaacgcaaagatataa

DBGET integrated database retrieval system