KEGG   Aedes aegypti (yellow fever mosquito): 5573238Help
Entry
5573238           CDS       T01053                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    5573238
  Energy metabolism
   00190 Oxidative phosphorylation
    5573238
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     5573238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 289 aa AA seqDB search
MALVCDLKMLLACRGAFGQIRNIHLAAANNAAAKKVKKFQIYRWNPDKPEQKPYNQTYEV
DLSACGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDADNLD
KPTKVYPLPHMYVVKDLVPDMNNFYNQYRSIQPWLQRKNEAGEKKGDAQYLQSVDDRAKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWIIDSRDESTAARLDKLKDPFSV
YRCHTIMNCTRTCPKGLNPGKAIAEIKKLLSGIAKKDAPGLETAALHGK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggccctggtgtgcgatttgaagatgctgctggcctgccgcggtgcctttggtcagatc
agaaacatccatctggcggccgctaacaatgccgcggccaagaaggtcaagaagttccaa
atctaccgttggaatccggacaagcccgagcagaagccatacaaccagacctacgaagtg
gatctgagcgcctgcggcccgatggtgctcgatgccctcatcaagatcaagaacgaaatc
gaccccacgttgacgttccgtcgttcgtgtcgcgagggcatttgcgggtcgtgtgcgatg
aacatcggaggcaccaacacgttggcgtgcatcagcaagatcgatgccgacaacttggac
aagccgaccaaggtgtacccgttgccgcacatgtacgtggtgaaggacttggtgccggac
atgaacaatttctacaaccagtatcgctcgatccagccgtggctgcagcgcaagaacgaa
gccggcgagaagaagggcgatgcccagtacctccagtcggtggacgaccgcgccaagctg
gacggtttgtacgagtgcattctgtgtgcttgttgctccacctcgtgtccctcgtactgg
tggaacggcgacaagtatcttggtccggccgtccttatgcaggcctaccgttggattatc
gattcccgtgacgaatcgacggccgctcggttggacaagctgaaggatccgttcagcgtt
taccggtgccacaccatcatgaactgcacacgcacctgcccgaagggtctcaatccgggt
aaggcaattgccgagatcaagaaactgctgtccggtatcgccaagaaggacgcccccgga
ctggaaacggccgctctgcacggtaagtaa

DBGET integrated database retrieval system