KEGG   Aedes aegypti (yellow fever mosquito): 5576553Help
Entry
5576553           CDS       T01053                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00250  Alanine, aspartate and glutamate metabolism
aag00280  Valine, leucine and isoleucine degradation
aag00410  beta-Alanine metabolism
aag00640  Propanoate metabolism
aag00650  Butanoate metabolism
aag01100  Metabolic pathways
Module
aag_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    5576553
   00650 Butanoate metabolism
    5576553
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    5576553
   00280 Valine, leucine and isoleucine degradation
    5576553
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    5576553
Enzymes [BR:aag01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     5576553
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     5576553
Amino acid related enzymes [BR:aag01007]
 Aminotransferase (transaminase)
  Class III
   5576553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 5576553
NCBI-ProteinID: XP_021697848
LinkDB All DBs
Position
2
AA seq 495 aa AA seqDB search
MSLKTLSVAAVRLEAQRHNSLQKLCRTFATQLSEPNGPSVKTAIPGPKSKELLKQLNALQ
QGGSVQLFADYERSVGNYLQDVDGNVLLDIYTQISSVPLGYNHPELLKVFKYDHNLKSLI
NRPALGVFPGEDWPRKLQNVLMTVAPKGLDHLTTMMCGSCSNENAFKNIFIWYQRVRRGE
NVSFSEEEINSCMINQAPGAPKLSIMSFHGAFHGRTLGTLSTTHSKYIHKIDIPSFDWPI
APFPKYRYPLEENVRENAQEDARCLAEVESLFEKYAKKGIPVAGVIVEPIQSEGGDNEAS
PEFFQGLQRVTKKNGAALLIDEVQTGGGPTGKIWCHEHFNLDGPPDVVTFSKKMQLGGYF
HNLNMTPKLPYRVFNTWMGDPGKVLLLESILNVIKSESLLQNVEKTGAKLKKGLLQAQKD
YPHLLNSARGRGTFLAINCANAKMRDDAVAALKQKGVLSGGCGDLSIRFRPALIFQEKHV
DIFLDKFNQVLKELK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgaagaccttgagtgtggccgcagttcggcttgaagctcagaggcataattcg
ctgcagaaattgtgccgaacattcgcgacccagctgagtgagcctaatggtccatctgtc
aaaactgccatccctggaccgaaatccaaggagctgctaaaacaactcaatgcactgcag
caaggagggtcggtgcagctgttcgccgactacgagcgatccgttggcaactacctgcag
gatgtcgatggcaacgtgctgttggacatttacacccagatatcgtctgtaccgctggga
tacaaccatccggagctgctgaaagtgttcaaatatgaccacaatctcaaaagcctcatc
aaccggcctgcccttggtgtcttcccgggtgaggattggccccgtaagcttcaaaacgtc
ctaatgaccgtcgccccgaagggtctcgatcacctgacgacgatgatgtgcgggtcctgt
tccaacgaaaatgcgttcaagaacatcttcatttggtatcagagagttcgccgcggcgaa
aatgtgtcgttctccgaagaggaaatcaattcctgcatgatcaaccaggctcccggtgcg
cccaagctgagtatcatgagcttccacggagcgttccatggtcgcactttgggaacgtta
tcgaccacccactccaaatacatccacaagattgacatcccgtcgttcgattggccgatt
gccccattccccaagtacaggtacccgctggaggaaaatgttcgcgagaatgcccaggag
gatgctcgttgcctggcggaagtcgaaagcctgttcgagaagtacgccaagaagggcatt
ccggttgcaggagtgattgttgaacccattcagagtgagggtggcgataacgaggcatct
cccgagttcttccaaggacttcagagggtcaccaagaagaacggtgctgctctgctgatc
gatgaggttcaaactggcggtggcccaacgggcaagatctggtgtcacgaacactttaat
ttggacggccctccggatgtggtcactttcagtaagaaaatgcaactgggaggatacttt
cacaatctgaacatgactccgaagctgccgtaccgtgtgttcaacacttggatgggtgat
ccaggtaaggtgctgctgctggaatcgatcctgaacgtgatcaagtcggaatccttgctg
cagaacgtggagaaaaccggtgctaagctgaagaagggattgcttcaggctcagaaggat
tatccccatctgctcaattctgctaggggacgtggaacgttcttggcaatcaactgtgcc
aacgccaagatgcgcgatgatgccgtggcagctttgaaacagaagggtgttctctctgga
ggttgcggcgacttgagcattcgattccgaccggccctgattttccaggaaaagcacgtt
gacattttcctggataaattcaaccaagtcctcaaggagcttaaatga

DBGET integrated database retrieval system