KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004823Help
Entry
AaeL_AAEL004823   CDS       T01053                                 

Gene name
MNSOD1
Definition
(RefSeq) AAEL004823-PA
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    AaeL_AAEL004823 (MNSOD1)
   04068 FoxO signaling pathway
    AaeL_AAEL004823 (MNSOD1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AaeL_AAEL004823 (MNSOD1)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    AaeL_AAEL004823 (MNSOD1)
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AaeL_AAEL004823 (MNSOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 219 aa AA seqDB search
MLALRSAVLVSTRNVAAVLGCRNKHTLPDLPYDFGALEPVICREIMEVHHQKHHNAYVTN
LNAAEEQLAEAVAKKDTSKIIQLGGALKFNGGGHINHSIFWKNLSPERSDPSAELKKLLE
RDFHGLENFKKEMKAAAVAVQGSGWAWLGYNQKTKALQVAACPNQDPLQATTGLVPLLGI
DVWEHAYYLQYKNLRPNYVDAIWDVVNWKDVSERLAKAQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttggctcttcgcagtgctgttctggtatctaccagaaatgttgcagctgttctggga
tgtcgcaacaagcataccctgccggatcttccgtacgactttggcgctctggagccggtc
atctgccgtgaaatcatggaggttcaccaccagaagcaccacaatgcctatgtgaccaat
ttaaacgccgccgaggagcagttggcggaagccgttgcaaagaaggacacttccaagatc
attcagctgggtggtgcactcaagttcaacggcggtggtcacatcaaccattcgattttc
tggaagaatctctcgccggaacgctcggatccgtcggcggagctgaagaagctgttggag
cgcgacttccacggattggaaaacttcaaaaaggaaatgaaagccgccgctgttgccgtg
cagggatccggttgggcatggctgggctataatcagaagacgaaagccctgcaggtggcc
gcctgccctaaccaggacccgctgcaagctactacgggattggttccactgttgggaatc
gacgtttgggagcatgcgtactatttgcagtacaaaaatctccggccgaactacgttgat
gctatttgggatgtcgtcaactggaaggatgtttccgaacgtctggccaaggcacaataa

DBGET integrated database retrieval system