KEGG   Glutamicibacter arilaitensis Re117: AARI_19040Help
Entry
AARI_19040        CDS       T01320                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aai  Glutamicibacter arilaitensis Re117
Brite
Enzymes [BR:aai01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AARI_19040 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CBT76122
UniProt: E1VWW9
LinkDB All DBs
Position
complement(2166923..2167552)
Genome map
AA seq 209 aa AA seqDB search
MAVYSLPELQYDYAALEPNISARIMELHHSKHHATYVAGANSALEQLAEAREKGEFGNIP
KLSKDLAFHLGGHTNHSIFWNNLSPEGGDKPEGELAAAIDDFFGSFDAFRGHFTASAMSL
QGSGWAVLAYDALGGQLVIEQLYDQQGNIPVATTPLLMLDMWEHAFYLDYVNVKADYVKA
FWNIVNWADVQARFEAARKGAASLIVPGK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttattcactgccagaactgcagtacgactacgccgcactggagccgaacatc
tcggctcgcatcatggagctgcaccactccaagcaccacgcaacctacgttgctggcgca
aactcggcactggagcagttggctgaagctcgcgaaaagggcgaattcggcaacatccct
aagctgtccaaggacctggcattccacctcggtggccacaccaaccactcgatcttctgg
aacaacctgtccccagaaggcggcgacaagccagagggcgagttggcagcagccatcgac
gacttcttcggttccttcgacgctttccgcggccacttcaccgcttcggccatgagcctg
cagggctccggctgggcagttctggcttacgacgcactgggcggccagctggtcatcgag
cagctctacgatcagcagggtaacatcccagtggcaaccaccccgctgctgatgctggac
atgtgggagcacgccttctacctggactacgtcaacgtgaaggctgactacgtcaaggcc
ttctggaacatcgtgaactgggcagatgtccaggctcgtttcgaagcggcccgcaagggt
gcagcatcgctgatcgttccaggtaagtga

DBGET integrated database retrieval system