KEGG   Aeromonas aquatica: BOQ57_08385Help
Entry
BOQ57_08385       CDS       T04629                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
aaj  Aeromonas aquatica
Brite
Enzymes [BR:aaj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BOQ57_08385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: APJ14946
LinkDB All DBs
Position
1795689..1796351
Genome map
AA seq 220 aa AA seqDB search
MIDFYTAATPNGFKVAIALEELGLPYRVIPLDLSALDQKKPEFLAINPNGRIPAIVDRDN
GDFAVFESGAILLYLAEKAGKLLPADPKRRSQAIQWLMFQMGGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVLDSHLAHHEYLADEYSIADIATWPWVRIHDWSGISIEGLPH
LQAWMDRMAEKPACQKGITIPPRNEKPEDLVKQAQQMVTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttttacaccgccgctacgcccaacggcttcaaggtggcgattgccctggaa
gagctgggcttgccctaccgggtgatcccgctcgatctgtcggcgctggatcagaagaag
cccgagtttctggccatcaaccccaacggccgtatcccggccatcgtcgatcgggataat
ggtgacttcgccgtgttcgagtccggcgccatcctgctttatctggcggagaaggcgggc
aagttgctgccggcagatcccaagcgccgctcccaggccatccagtggctgatgttccag
atgggcggggtcggtcccatgatggggcaggccaacgtcttctatcgctacttcccggag
aagatcccggccgccatcgagcgctaccagaaggaggggcgccgtctgttcgaggtgctc
gacagccatctggcccatcacgaatatctggccgacgagtacagcatcgccgacatcgct
acctggccctgggtgcgcattcatgactggagcggcatctccatcgaggggttgccgcat
ctgcaagcctggatggaccggatggcagagaagcccgcctgccagaaggggatcaccata
ccgccgcgcaacgagaagccggaggatctggtcaaacaggcccagcagatggtaacgcgt
tga

DBGET integrated database retrieval system