KEGG   Aminobacter aminovorans: AA2016_0499Help
Entry
AA2016_0499       CDS       T04343                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
aak  Aminobacter aminovorans
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aak00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AA2016_0499
   00650 Butanoate metabolism
    AA2016_0499
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AA2016_0499
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AA2016_0499
Enzymes [BR:aak01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AA2016_0499
Amino acid related enzymes [BR:aak01007]
 Aminotransferase (transaminase)
  Class III
   AA2016_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
513333..514607
Genome map
AA seq 424 aa AA seqDB search
MKNAEISQRKMQTIARGVGMTTQVYADRAENSEIWDVEGRRYIDFSSGIAVVNTGHRHPR
VIEAVKAQLDRFTHTCHQVVPYESYVRLGERLNAIAPMKGDKRTIFVTTGAEAVENAVKI
ARNATGRQAVIAFAGGFHGRTFMGMALTGKVQPYKAGFGAMPADVFHAPFPVPLHGVTTA
DALAALDRLFKADVDPARVAAIIIEPVQGEGGFYEVPRDFMTALRKICDQHGMLLIADEV
QTGFARTGKMFAMDHHDVAPDLMTMAKSLAGGFPLAAVTGRAELMDAPNPGGLGGTYGGS
PIGVAAAHAVLDVIEDEKLCDRANQLGARLKQRLESLRDDVPEISDIRGLGFMNAVEFND
AKTKLPSADFANAVRLKALDKGLILLTCGVHGNVIRFLAPITIQDDVLTEALDILEASIR
EVRT
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgccgaaatttcacagcgcaagatgcagaccattgcccgcggcgtcggcatg
acgacgcaggtctatgccgaccgcgccgagaactccgagatctgggatgtcgaaggccgc
cgctacatcgacttctcttccggcatcgccgtcgtcaacaccggccatcgccacccgcgc
gtcatcgaggcggtcaaggcacagctcgaccgcttcacccatacctgccatcaggtcgtg
ccctatgaaagctatgtcaggctcggcgaaaggctgaacgcgatcgcgccgatgaagggc
gacaagcgcacgatcttcgtcacgacaggcgccgaagccgtcgagaacgccgtcaagatc
gcccgcaacgccaccggccgccaggccgtcatcgcctttgccggcggcttccacggccgc
acattcatgggcatggcgctgaccggaaaggtgcagccctacaaggcaggcttcggcgcc
atgccggccgatgtgttccatgcgcccttcccggtgccgctgcatggcgtcaccacggcc
gatgcgctggcggcgctcgaccggctgttcaaggcagatgtcgacccggcgcgggtggcg
gccatcatcatcgagccggtgcagggcgaaggcggcttctacgaggtgccgcgcgacttc
atgacggcgctgcgcaagatctgcgaccagcacggcatgctcttgatcgccgacgaggtt
cagaccggctttgcgcgcaccggcaagatgttcgccatggaccatcatgacgtcgcgccc
gacctgatgacgatggcgaaaagcctcgccggtggcttcccgctggccgccgtcaccggc
cgcgccgaactgatggacgcgcccaatcccggcggcctcggcggcacctatggcggcagc
ccgatcggtgtcgcggcagcacacgccgtgctcgacgtcatcgaggacgaaaaactctgc
gaccgcgccaatcagctcggcgcgcggctcaagcagcggctggaatccttgcgcgacgac
gtgccggagatatcagacatccgcggtctcggcttcatgaatgctgtcgagttcaacgac
gcaaagaccaagctgccctcggccgacttcgccaacgccgtcaggctcaaggcgctcgac
aagggcctgatcctgctcacctgcggcgtccacggcaacgtcatccgtttcctcgcgcca
atcaccatccaggacgacgtcctgaccgaggcgctcgatattctggaggcgtcgatccgg
gaagtgcggacataa

DBGET integrated database retrieval system