KEGG   Aminobacter aminovorans: AA2016_0589Help
Entry
AA2016_0589       CDS       T04343                                 

Definition
(GenBank) hypothetical protein
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
aak  Aminobacter aminovorans
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aak00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AA2016_0589
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AA2016_0589
Enzymes [BR:aak01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AA2016_0589
Peptidoglycan biosynthesis and degradation proteins [BR:aak01011]
 Precursor biosynthesis
  Racemase
   AA2016_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
609533..610666
Genome map
AA seq 377 aa AA seqDB search
MTMGVQSDIESRAACGVLTIDLDALVENYRQLSQRNAPERTAAVVKADAYGLGVAEVAPV
LYAAGCRDFFVAHFIEAVRLKPHLTADARILVLNGLMPGSEADCADLGVVPVLNSLEQVA
NWSATSRARNVTLPAALQADTGMSRLGLEPQELETLIAEPHRLDGIHIDIVMSHLACGDE
PAHDANARQLGRMRDVRARFPDAKLSFANSAGIFLGDDFHGDLARPGIALYGGAPLGEGV
NPMQQVVRLDVGVVQTRTVTAGAEVGYGASFVARSEMRLATIAAGYADGLPRHLSNSGAA
WFGDVRLPIVGRVSMDSIILDVTGLPTGTLKLGDMVELIGPHQTLEMIASDAGTISYEIL
TSLGRRYRRRYLSPAAR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgggcgtgcaaagcgacattgagagccgtgcggcatgcggcgtgctgaccatc
gatctcgacgctctggtcgagaactatcggcagctgagccagcgcaacgcgcctgaaagg
accgcggcggtggtcaaggccgatgcctatgggctcggcgtggccgaggttgccccggtt
ctatacgccgccgggtgccgcgacttcttcgtcgcccatttcatcgaagcggtcaggctg
aagccgcatctcactgctgacgcacgcatcctggtgctcaacggtctgatgccgggcagc
gaggccgattgcgccgacctcggcgtggtgccggtgctgaactcgctcgaacaggtcgcc
aactggtcggccacgtcgagggcgcgcaacgtgacgttgccggcagcactccaggccgac
accggcatgtcgcggctcgggctcgagccgcaggagctggaaacgctgatcgccgaacca
caccggctcgacggcatccacatcgacatcgtgatgagccatctcgcctgcggcgacgag
ccggcgcatgatgccaacgcccgccagctcggacggatgcgggacgtgcgcgcacgcttc
cccgatgccaagctgtcctttgccaattccgccggcatcttcctgggcgacgattttcat
ggcgatctcgcccggccgggcatagcgctctatggcggcgcgccgctcggcgagggcgtc
aatccgatgcagcaggtggtccgcctcgacgtcggcgtcgtccagacccgcaccgtgacg
gcgggtgccgaggtgggctatggggcaagcttcgtcgccaggtccgaaatgcggctcgcc
accatcgccgcaggttatgccgacggcctgccgcgccatctcagcaattcaggcgctgcc
tggttcggtgacgtgcgcctgccgatcgtcgggcgcgtgtcgatggacagcatcattctc
gacgtcaccggcttgccgaccggaacattgaagcttggcgacatggtcgaactgatcggc
ccgcaccagacgctcgaaatgatcgcgtcggatgccggcaccatttcctacgaaatcctg
accagcctgggccggcgctacagacgccgctacctcagcccggcagcgcgctaa

DBGET integrated database retrieval system