KEGG   Aminobacter aminovorans: AA2016_4141Help
Entry
AA2016_4141       CDS       T04343                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aak  Aminobacter aminovorans
Pathway
aak00564  Glycerophospholipid metabolism
aak01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aak00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AA2016_4141
Enzymes [BR:aak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AA2016_4141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 NAD_binding_8 Mqo STPPase_N
Motif
Other DBs
NCBI-ProteinID: AMS43058
UniProt: A0A142M9N8
LinkDB All DBs
Position
4238897..4240426
Genome map
AA seq 509 aa AA seqDB search
MSRPEIHDIFVIGGGINGCGIARDAVGRGYSVYLAEMNDLASGTSSYSTKLIHGGLRYLE
HYEFRLVREALMEREVLWKNAPHIIWPMRFVLPYAKGLRPAWLIRLGLFLYDHIGGRKLL
PPTRTLDMHSDVAGKPLKPMFARAFEYSDGWVNDARLVVLNARDAADRGAVIRTRAKVTS
ARRDNGHWNIRVEDLRSGQVEEVKARLIVNAAGPWIDHVLTETVGQNNVHNVRLVQGSHI
VVAKKFDDPRAYFFQNKDGRIIFAIPYEEDFTLIGTTDQDYQGDPHTARISQAEITYLCE
AASEYFAEPVKPEHIVWTYSGVRPLYDDGASKAQEATRDYVLKSDGGEGRAPIVNIFGGK
ITTYRRLAESMLEIIEKQLGKRGKAWTATAALPGGEFEATGFDAEVVKLKAAYPFLDMRL
ARRLTRLYGTRARTLLGLAKSEADLGRNFGADLYEAEVRYLVAHEWAVSGEDVLWRRTKR
GLKLSKEQAAALDEFLHGMSPGVHNAAAE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaccagaaatccacgacatcttcgttatcggcggcggcatcaatggctgcgga
atcgcccgcgacgcggtcggccgcggctactccgtctaccttgccgaaatgaacgatctc
gcctccggcacctcgtcctattcgaccaagctgatccatggcgggctgcgctatctcgag
cattacgaattccgcctggtgcgcgaagcgctgatggaacgcgaggtgctgtggaagaac
gcgcctcacatcatctggccgatgcgcttcgtgttgccctatgccaagggcctgcgcccg
gcatggctgatccggctcggcctgttcctctacgaccatattggcggccgcaagctgttg
ccgccgacacgcacgctcgacatgcacagcgacgtcgccggcaagccgctgaagccgatg
tttgcgcgcgccttcgaatattccgacggctgggtcaacgatgcacggctggtcgtgctc
aatgcccgcgacgccgccgacaggggtgccgtcatccgcacccgggccaaggtgacgagc
gcgcgccgcgacaacggccattggaacatccgcgtcgaggacctgcgcagcggccaggtc
gaagaggtcaaggcgcggctcatcgtcaatgccgccggaccctggatcgaccatgtgctg
accgaaaccgtcggccagaacaacgtccacaatgtccgcctcgtccagggcagccacatc
gtggtggcgaagaagttcgacgatccgcgcgcctatttcttccagaacaaggacgggcgc
atcatcttcgccattccttacgaggaagacttcaccctgatcggcaccaccgaccaggat
tatcaaggcgacccccacaccgccaggatcagccaggccgagatcacctatctctgcgag
gcggcaagcgaatatttcgccgagccggtgaaacccgaacacatcgtctggacctattcc
ggcgtccgcccgctttatgacgacggcgccagcaaggcccaggaagcgacacgcgactat
gtgctgaaatcagatggcggcgaaggccgcgcgccgatcgtcaatatcttcggcggaaag
atcaccacctatcgccgccttgccgaatccatgctcgagatcatcgagaagcagctgggc
aagaggggcaaggcctggacggcaaccgccgccctgccgggcggcgagttcgaggcgacc
ggcttcgacgccgaagtggtcaagctcaaggctgcctaccccttcctcgatatgcgcctc
gcccgccgcctgaccaggctctacggcacacgcgccaggacgctgctcggcctggcgaag
tcggaagccgatctcgggcgcaatttcggcgccgatctctacgaggccgaggtccgctat
ctcgtcgcccatgaatgggcggtgagcggcgaggacgtgttgtggcggcgcaccaagcgg
gggctgaagctcagcaaagagcaggccgcggcactcgacgaatttctgcatggaatgagc
ccaggcgtgcacaacgccgcggcagaatag

DBGET integrated database retrieval system