KEGG   Alternaria alternata: CC77DRAFT_1040647Help
Entry
CC77DRAFT_1040647 CDS       T05291                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aalt  Alternaria alternata
Pathway
aalt00020  Citrate cycle (TCA cycle)
aalt00310  Lysine degradation
aalt00380  Tryptophan metabolism
aalt01100  Metabolic pathways
aalt01110  Biosynthesis of secondary metabolites
aalt01130  Biosynthesis of antibiotics
aalt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aalt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CC77DRAFT_1040647
  Amino acid metabolism
   00310 Lysine degradation
    CC77DRAFT_1040647
   00380 Tryptophan metabolism
    CC77DRAFT_1040647
Enzymes [BR:aalt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CC77DRAFT_1040647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 29112806
NCBI-ProteinID: XP_018386336
JGI: 1040647
UniProt: A0A177DMG3
LinkDB All DBs
Position
Unknown
AA seq 1044 aa AA seqDB search
MLRNTLRQCSRSLQCAPARATFSSLAQPSRNAISTCRRPLALTQRRGYAVSSEDTNKGVD
PNDSFLQGNTANYIDAMYMQWKQDPASVHYSWQVYFHNMESGDMPVSQAFQPPPNIMSSP
QGGAAHKPGMGMASAEGTDVMNHLKVQLLVRAYQARGHHKAKIDPLGIRSEAEQFGYSKP
RELELSHYNFTEKDLEQEIELGPGILPRFKTETRKKMKLKEIIEACERLYCGSYGIEYIH
IPDREQCDWLRERIEVPTPFKYSVDEKRRILDRLIWGTNFEAFLATKYPNDKRFGLEGGE
SLIPGMKALIDRSVDFGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTAEANEEGS
GDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAILHYNNDEKEASSAM
GMLLHGDAAFAGQGIVYETMGFHQLPSYHTGGTIHIIVNNQIGFTTDPRFSRSTPYCSDI
AKAIDAPVFHVNGDDVEALNFVCQLAADFRAEFKKDVVIDMVCYRKQGHNETDQPFFTQP
LMYKKISEQPQTLDIYTKKLLDEKTFTKEDIDEHKAWVWGMLDESFNRSKDYVPNSKEWL
TSAWNGFKSPKELAEEVLPHLPTAIEETQLQHIAEKIGGAPEDFNVHKNLKRILAGRTKT
VMDGKNIDMATAEALAFGSLCMEGHHVRVSGQDVERGTFSQRHAVLHDQETEKTYTPLQN
LSEDQATFTISNSSLSEYGVLGFEYGYSLSSPNALVMWEAQFGDFANTAQVIIDQFIASG
EVKWLQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRIFPSPDKLDRQHQDCNIQ
IAYTTKPSNLFHLLRRQMNRQFRKPLILFFSKSLLRHPLARSSIEEFTGDSHFQWIIEDP
AHATGEIESHEGINRVILCTGQVYAALVKEREARGEKDVAITRIEQLNPFPWQQLKDNLD
SYPNAQNIIWCQEEPLNAGAWSFTQPRIETLLNQTEHHNRRHVMYAGRNPSASVATGLKV
SHKNEEKALLDMAFTVKQDKLKSE
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaacaccctgcgccagtgctcccgctcgctccagtgcgccccggcgagagca
accttctcgagcctcgcacagccatcacgaaacgccatctcgacatgtcgcaggccgctt
gcgctgacgcagcgccgcgggtatgccgtgtcgtcggaagacaccaacaagggcgttgac
cccaacgactcgttcctccagggcaacacggccaactacatcgatgccatgtacatgcag
tggaagcaggaccccgccagcgttcactactcatggcaggtctacttccacaacatggag
tccggcgacatgcccgtgtcgcaagccttccaaccgccgcccaacatcatgagctcgccc
cagggcggcgctgctcacaagcccggaatgggcatggcttccgccgaaggtaccgacgtt
atgaaccatctcaaggtccaattgcttgtgcgagcgtaccaggctcgtggtcaccacaag
gccaagattgacccgctgggcatccgctcagaggcagagcagttcggatacagcaagccg
cgcgagcttgagctttcccactacaacttcaccgaaaaggacctggaacaggagattgaa
ctaggcccgggtatcctaccgcgcttcaagaccgagacccgcaagaagatgaagttgaag
gagatcatcgaggcctgtgaacgcctctactgcggctcctacggtatcgaatacatccac
attcccgacagggagcagtgcgactggctccgtgagcgcatcgaggtccccacgcccttc
aagtactctgtcgacgagaagcgccgcatcttggaccgcctgatctggggaaccaacttt
gaggctttcctggccaccaagtaccccaacgacaagcgatttggtcttgaaggaggcgag
agtttgattcctggaatgaaggccctcatcgaccgaagtgtcgacttcggcgtcaaggac
atcgtcattggtatgccgcatcgtggacgtctcaacgtgctctccaacgtcgtcaggaag
cccaacgagtccatcttcagtgagtttgccggtactgccgaagccaacgaagagggctct
ggtgatgtcaagtaccacttgggtatgaacttcgagcgtcctacgccatccggaaagcgt
gtgcagttgtctcttgtcgccaacccgtcccatcttgaagctgaagaccccgtcgtcctg
ggcaagacccgcgccatcctccactacaacaatgacgagaaagaggcttccagcgccatg
ggtatgctcctccacggtgacgccgctttcgctggtcaaggtatagtgtatgagaccatg
ggtttccaccagctgcccagctaccacaccggcggaaccatccacatcattgtcaacaac
cagattggtttcactacggatcctaggttctctcgctctactccatactgttcggacatt
gccaaggccattgacgcacctgtcttccacgtcaacggtgacgacgtcgaggctctcaac
ttcgtctgccagctggctgccgacttccgtgctgagttcaagaaggatgtagtaatcgac
atggtctgctaccgaaagcagggtcacaacgagactgaccagcctttcttcacccagcct
ctgatgtacaagaagatctcggaacagcctcaaacactagacatctacaccaagaagttg
ctcgacgagaagaccttcaccaaggaggacattgacgagcacaaggcttgggtctggggc
atgctagacgagagcttcaaccgcagcaaggactacgtaccaaactccaaggagtggctt
acttcggcctggaacggcttcaagtcgcccaaggaactcgcagaagaggttctgccccat
ctgccaactgccattgaggaaactcaattgcagcacatcgcagagaagattggcggtgca
ccagaggacttcaatgtgcacaagaacttgaagcgtattttggctggccgcaccaagact
gtcatggatggcaagaacatcgacatggctactgcggaagcgttggcatttggaagtttg
tgcatggaaggccatcacgttcgtgtttctggacaggatgtcgagcgtggaaccttctcc
cagcgccacgctgtgctccacgaccaggagactgagaagacctacacccctcttcagaac
ctcagcgaggaccaggccaccttcaccatctctaactcttctcttagcgaatacggagtg
cttggcttcgaatacggttactccttgtcttcacccaacgccctcgtcatgtgggaggct
cagtttggtgactttgccaacactgcccaggttatcatcgatcagttcattgcctctggt
gaagtcaagtggcttcagcgttccggtctcgtcatgagcttgccgcacggttacgatggt
caaggtcctgaacactcgtcaggacgtatggagcgctacttgcagctctgcaacgaggat
ccccgcatcttcccgtcccctgacaagcttgaccgccagcaccaggactgcaacatccag
attgcctacacaacgaagccgtccaacctcttccatctccttcgtcgtcaaatgaaccgc
cagttccgcaagcctcttatcttgttcttctccaagtcgctactccgccacccgctcgct
cggtctagcattgaggagttcactggtgactcgcacttccagtggatcatcgaagaccct
gcgcacgctactggagagattgagtcgcacgagggcatcaaccgtgtcatcctctgcaca
ggtcaggtgtacgctgcgcttgtcaaggagcgtgaagcacgtggcgagaaggatgttgcc
attacccgtatcgagcaacttaaccccttcccatggcagcaactgaaggacaacctcgac
tcgtaccccaacgcgcagaacatcatctggtgccaggaggagccccttaacgccggtgcc
tggagctttacacagcccagaatcgagacgcttctcaaccagaccgagcaccacaacaga
cgacacgtcatgtacgctggacgcaaccctagtgcatctgtagcaactggactcaaggtg
tctcacaagaacgaggagaaggctctgctagacatggccttcacggtcaagcaggacaag
ctgaagagcgagtag

DBGET integrated database retrieval system