KEGG   Apteryx australis mantelli (brown kiwi): 106484668Help
Entry
106484668         CDS       T04298                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aam00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106484668 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    106484668 (SDHB)
Enzymes [BR:aam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106484668 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 283 aa AA seqDB search
MAAAVVAVSLRRGVLGRPLLLICRGAQTAAAAAPASQAAPRIKKFAIYRWDPDKPGDKPR
MQTYEVDLNKCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNIAGGNTLACTKRI
DTDLSKITKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKAQYLQSIEDR
QKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDP
FSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKAATA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgtcgtcgcagtctccttgaggcgcggcgtcctggggcgaccgctgctg
ctgatatgtcggggagctcagacggcagctgcagccgctccagcttcgcaggcggcacca
cgtatcaagaaatttgccatttacagatgggatcctgataagcctggggacaagccccgc
atgcagacttacgaagtggatttgaataaatgtgggcctatggtgcttgacgctctgatc
aagataaaaaatgagatggactccactctgaccttccgcagatcttgtagggaaggcatc
tgtggttcttgtgctatgaacattgctggaggaaacacactggcctgcaccaaaagaatt
gacactgatctcagcaagatcactaaaatctaccctctcccccacatgtatgtggtgaag
gatcttgttccagacctgagtaacttctatgcacagtataaatccattgagccttacctg
aagaagaaggatgagtcgaaacagggcaaggcgcagtacctgcagtccatagaagaccgt
cagaaactggacggactctacgagtgcattctgtgtgcctgctgcagcaccagctgtcct
agttactggtggaacggggacaagtacttgggccctgcggtactgatgcaggcctaccgc
tggatgattgactccagagatgactacacagaggaacgcctggcacagcttcaggaccca
ttttctctctaccgttgtcacactatcatgaactgcacaaggacttgccctaagggtttg
aaccccggcaaagcgattgctgaaatcaagaaaatgatggcaacgtacaaagagaaggcg
gccactgcgtaa

DBGET integrated database retrieval system