KEGG   Apteryx australis mantelli (brown kiwi): 106487237Help
Entry
106487237         CDS       T04298                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:aam00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106487237 (CDC23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    106487237 (CDC23)
   04114 Oocyte meiosis
    106487237 (CDC23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106487237 (CDC23)
Ubiquitin system [BR:aam04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     106487237 (CDC23)
Chromosome [BR:aam03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    106487237 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 539 aa AA seqDB search
MIYLKHARXSEVLNLSLSLQEDARDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLY
MYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHKARELDGFGLYLYGVV
LRKLDLVKEAIDVFVEAAHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIY
TELQLIEEALQKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIE
NMDTFSNLLYVRSMKPELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRAL
KLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYC
LYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHE
QLNESEQAAQCYIKYIQDIYSCGEIVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCA
FNDTREEGKALLRQILQLRNQGETSSTEIAAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgatttacctaaagcatgccagannttctgaggtcttgaacttgtctttgtctctgcag
gaggatgctcgtgatttggatgcctatacgttagccaagtcttacttcgatctaaaggaa
tatgacagggccgcatattttctgcggggctgcaagagtcagaaggcttacttcttgtat
atgtactctagatacctgtcaggagaaaagaagaaggatgatgaaacagtggatagtttg
ggacctctggaaaaagggcaggtaaaaaacgaagctcttcgagaattaagagtagagctt
agtaagaaacacaaagcacgagaactggatggatttggcctttatttgtatggtgttgtg
ctgcggaagctggacctggtgaaagaagccatagatgtatttgttgaagctgctcatgtc
ttacctttgcactggggagcctggctggaactttgcaacttgatcacagataaagagatg
ttgaagttcctgtccttaccagatacatggatgaaagagttctttcttgcacacatttat
acagagctgcagctgatagaggaggctctgcagaagtatcagagtctcattgatgcagga
ttttccaaaagcacttacatcatctctcagattgcagttgcctaccacaacatccgagat
attgacaaagctttatccatctttaacgagctaagaaaacaagacccttacagaatagaa
aacatggacactttctccaacttgctgtatgttaggagcatgaagcctgagttgagctac
ctggctcacaatctctgtgagatagacaagtatcgtgtggagacctgctgcgtaattgga
aattattatagtttacgctcccaacatgaaaaagcagcactttatttccagagagccttg
aaactaaatcctcggtatctgggagcctggacacttatgggacatgagtatatggaaatg
aagaacacatctgcagctattcaagcttatagacatgcgatagaggtgaacaaaagggac
tacagagcctggtatggcttggggcaaacctatgaaatcctcaaaatgccattttactgt
ctctattactaccgacgggcccaccagctcagacccaatgattcccgtatgctggttgct
ctaggagaatgctatgagaagctcaaccagttggtggaagctaaaaagtgctattggaga
gcctatgctgttggagatgtggagaaaatggcattggtaaaactggcaaagctgcatgaa
cagctgaatgaatctgaacaagctgctcagtgctatatcaaatacatccaggatatctat
tcctgtggggagatagtggagcacctggaggtcagtactgccttccgttacctggcccaa
tactacttcaagtgtaagctctgggatgaagcctcagcctgtgctcagaaatgctgtgca
ttcaatgatactagagaagaagggaaggccctgctgcggcagatcttgcagcttcgcaac
caaggagaaacttcgtccacagaaattgctgctccctttttcctccctgcatcactgtca
gccaacaacactcccacacgtcgtgtgtctccactcaatctgtcttctgttacaccatga

DBGET integrated database retrieval system