KEGG   Apteryx australis mantelli (brown kiwi): 106493813Help
Entry
106493813         CDS       T04298                                 

Definition
(RefSeq) trypsin II-P29
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
Neuroactive ligand-receptor interaction
Influenza A
Brite
KEGG Orthology (KO) [BR:aam00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106493813
 Human Diseases
  Infectious diseases
   05164 Influenza A
    106493813
Enzymes [BR:aam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     106493813
Peptidases [BR:aam01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106493813
Exosome [BR:aam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106493813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MKVFLILSCLGAVVAVPGDADDDKIVGGYNCPAHSVPYQVSLNAGYHFCGGSLINNQWVV
SAAHCYKSYIQVRLGEYNIDVQEDSEVVRSSAAIIRHPKYSSRSLDNDIMLIKLASPVAY
SADIQPIALPSTCVKAGTGCLISGWGNTLSSGSSFPEIVQCLQAPVLSDQECRDAYPGQI
SSNMMCVGFLEGGKDSCQGDSGGPVVCDGTLQGIVSWGIGCALKGYPGVYTKVCNYVNWI
QETIAAY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcttcctgattctctcctgcttgggggcagttgttgctgtcccgggggacgct
gacgacgacaagattgtgggaggctacaactgcccagcacattcagtgccctaccaggtg
tccctgaatgctgggtatcacttctgtggaggttccctcatcaacaaccaatgggtcgtg
tcagctgctcactgctacaagtcctatatacaggtgaggctgggagagtacaacattgat
gtgcaggaagacagtgaagtggtcaggagttctgcagcaatcattcgccatcctaaatac
agttcaagaagccttgataacgacattatgttgatcaagctggcatccccggtggcctac
agcgccgacattcaacccatagctctgcccagcacctgtgtcaaggcgggcaccgggtgc
ctgatttcggggtggggaaacacactgagcagcggctctagtttccctgagattgtccag
tgcctgcaagctccagtcttgagtgaccaagagtgccgagacgcttacccgggccagatc
tccagcaacatgatgtgtgtaggattcctggagggtgggaaagactcatgccagggtgac
tcgggcggcccagttgtgtgtgacgggacactccaggggatcgtatcatggggaatcggg
tgtgctctgaaaggctaccctggcgtctacaccaaggtctgcaattatgtcaactggatc
caagaaaccattgcagcctactga

DBGET integrated database retrieval system