KEGG   Apteryx australis mantelli (brown kiwi): 106495416Help
Entry
106495416         CDS       T04298                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aam00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106495416 (SETDB1)
Enzymes [BR:aam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106495416 (SETDB1)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106495416 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106495416 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 106495416
NCBI-ProteinID: XP_013811337
LinkDB All DBs
Position
Un
AA seq 1280 aa AA seqDB search
MDSQEIKELQQEVMEELGISMEELQDIIDEELEKFECVKQRKQQLEELEKCVKQKEEEVA
HVDRLFDDASRAIDKCEILVKDLYSKLGLQYRESSSEDEDLAAKATEVIEIPDEDDDDVM
SIDSGWKHSDTSSRIVKDQTLLREAMAAMRKSAQDVQKFMDAVNKKTNAQDTQKDGQTPQ
QTPGTLQPVSSAATGSDLSNDGDLKVGMRILGKKRTKTWHKGTLIAIQTVGAGKKYKVKF
DNKGKSLLSGNHIAYDYHPSPEKHYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKDRFL
IFFDDGYASYVKEWELYPICRPLKKTWEDIEDVSCRDFIEEYITAYPNRPMVLLKNGQLI
KTEWEGTWWKSRVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTQEKKQS
GQARTRPNVGAVRSKGPVVQYTQDLTGAGTQYKPLEQMQAASLAAARSVSPQPAEMEGSD
SQLAQSRKQVAKKSTSFRPGSVGSGQSSPASPVLSDTPPAGRTGTAQQHRFSSGQAGTGA
AQAFHGMMDRVPNEPSYRAPLEKLFYLPHVCSYTCLSRVRPIRSDQYRSKNPLLIPLLYD
FRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETDCDFLFLEMFCLDPYVLVD
RKFQPYKPYYYIADITKGREDVPLSCVNEIDNTPPPQVAYSKERIPGKGVYINTSWEFLV
GCDCKDGCRDKSKCACHQLTVQATGCTPGGQINPNSGYQHKRLEECLPTGVYECNKRCKC
NVNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGL
EMGDEYFANLDHIESVENFKEGYESDAKCSSDSSGVDLKDEEEENTGTEEQEESNEDSSD
DNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETASKDSGLTRQISHDETTVAASCKLP
VSEETSKNKVASWLSSNSMADSFQDNDSASSFKMSEGGEAKACKTELPGEREKASTSGLG
DVDGESKALKKDEPEDPNKLPGLSDLGRMYGYNPSPPKLEGIRRPTSKTALLQSRRHSVP
TQPSTDDVLTLSSSTDSEGENGQAAAGQAPGTTNDSDDIQTISSGSEEEEADDKKNPSSG
SGPVKRQVAVKSTRGFALKSTHGIAIKSTNMAAADKGESAPVRRTTRQFYDGEESCYIID
AKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGS
VEGKELLCCCGAIECRGRLL
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atggattcccaggagatcaaagagctgcagcaagaagttatggaggagctgggcatctcc
atggaggagctccaggacatcatcgatgaagagctggagaagtttgagtgcgtgaagcag
aggaagcagcagctggaggagctggagaagtgcgtgaaacagaaagaagaggaggtggct
cacgtcgaccggctctttgacgatgcttcgagagccattgataaatgtgagatattggta
aaagatctatactccaagctgggcctccagtatcgtgagagcagttctgaggacgaggac
ttggccgccaaggccacggaagtgatcgagatcccagatgaggacgatgatgacgtcatg
agcatcgattcaggctggaagcacagtgatactagttccagaatcgtgaaggatcagact
ctgctgcgggaagccatggctgcaatgagaaagtccgcccaagatgttcagaaatttatg
gacgctgtgaacaagaaaacaaatgcccaggatacacaaaaagacggacagacccctcag
caaactcctggcactctccagcctgtgagctctgctgccactgggagcgacctcagcaac
gatggtgacctgaaggttggcatgaggatcctgggcaagaagagaacgaagacgtggcac
aaagggacgctgattgcgatccagacagttggtgctggtaagaagtacaaagtgaaattt
gacaataaagggaagagtttgctctctggcaatcacattgcttatgactatcacccctca
cctgagaaacactacgttgggagcagggttgtggcaaaatacaaagatgggaatcaggtt
tggctgtatgctggcattgtggctgaaaccccaaacgtaaagaataaagacaggttcctg
atcttctttgacgatggctatgcttcatacgtcaaggagtgggagctgtacccaatctgc
aggccacttaaaaagacttgggaagatatagaggacgtatcctgtcgcgatttcatcgag
gagtacatcacagcctaccccaaccgtcccatggtgctgctgaagaatggccagctgatc
aaaacagagtgggaagggacctggtggaaatccagagtggaagaagtggatggcagcctg
gtcaaaatcctcttcctggatgacaaacgctgtgagtggatttaccggggttccacacgc
cttgagcccatgttcagcatgaaaacctccacagcctccacccaagaaaagaagcaaagt
ggacaagcgaggactcgtcctaatgtcggtgctgtcaggagcaaagggcccgtggtacaa
tatacgcaagatttaacgggagctggtacccagtacaaacctctagagcaaatgcaggca
gcctcgctggctgcagcacggtccgtttctccacagcctgctgagatggagggctccgac
agccagctggcccagtctagaaagcaagtggccaagaagagcacttccttccgtcccggc
tccgtgggatctgggcagtcctcacccgcttcacctgtcctaagcgatacgccgcctgcg
ggaaggaccggcacggcccagcagcatcggttctccagtggccaggcgggcactggcgca
gcacaggccttccacggcatgatggaccgtgtccccaacgagccctcgtaccgagccccg
ctggagaaactcttctacctgccgcacgtctgcagctacacctgcctgtcccgcgtccgc
cccatccgcagcgatcagtaccgcagcaagaaccccctgctcatcccgctgctctatgac
ttccgacggatgacggcccgccgacgggttaaccgcaagatgggcttccacgtcatctac
aagacgccgtgcgggctgtgcctgcgaaccatgcaggagatcgaacggtacctttttgag
acagactgcgacttccttttcctggaaatgttctgcctggacccctacgtgctggtggat
cgcaagttccagccctacaagccctactactacatcgcggacattaccaagggcagggag
gacgtgcccctgtcctgcgtcaacgagatcgataacaccccgcctccgcaggtggcctac
agcaaggagcgcatcccgggcaaaggggtttacatcaacaccagctgggagttcctcgtg
ggctgcgactgtaaagacggctgcagagacaaatcgaaatgtgcttgtcaccagctgaca
gtccaggcgactggctgcaccccaggcgggcagatcaaccccaattcaggataccagcac
aaaaggctggaagaatgcctcccgacaggagtctacgagtgtaacaagaggtgcaagtgc
aacgttaacatgtgcaccaatcgcttggtccaacacgggctccaagtccggctgcagtta
ttcaagacgcagaacaaaggctggggcattcgctgccttgatgatattgccaaaggctct
tttgtctgcatctacgcagggaaaatcctcaccgatgactttgctgacaaagaggggtta
gagatgggcgatgaatactttgcgaacctggaccacatcgagagcgtggagaacttcaag
gagggctacgagagcgacgcgaagtgctcttctgacagcagcggggtggacctcaaggac
gaagaggaggagaacacgggcactgaggagcaggaggagtccaacgaggatagctccgat
gacaatttctgcaaggacgaggacttcagcaccagctcagtgtggcgcagctacgccacg
cgacggcagacccggggccagaaggagaacgggctgtcggagacggcctccaaggactct
gggctcacccggcagatcagccacgacgagacaacggtggctgcctcctgtaagctgccg
gtgtctgaggaaacctccaagaacaaagtggcctcgtggctgagctccaacagcatggcc
gacagcttccaggacaacgacagtgcctcctccttcaagatgagcgaaggtggcgaagcc
aaggcctgcaaaacggaactgcctggtgagagagagaaagcctccacttctggcctgggc
gacgtggatggagagtcaaaggcgttgaagaaagatgaacctgaagatccaaacaaactt
cctgggctaagcgacttgggaagaatgtacggctacaacccaagtcctcccaagctggaa
gggatccggaggccgacgagcaaaaccgccctgctccagagcagacggcactctgtcccc
acgcagccctccacggacgacgtgctgaccctgtcgagcagcacggacagcgagggggag
aacgggcaggcggcggcagggcaggccccgggcaccaccaacgacagcgacgacatccag
accatttcctccggctccgaggaggaggaagcggatgacaagaaaaacccctcatctggc
tcaggtcccgttaagaggcaggtggcggtgaagtccacccgaggctttgccctgaaatca
actcacggcatcgccatcaagtcgaccaacatggcagcggccgacaagggcgagagcgcg
cccgtccgcaggaccacccgccagttctacgacggagaggagtcctgttacatcattgac
gccaaactggagggcaacctgggccgctaccttaaccatagctgcagccctaacctcttc
gtgcagaacgttttcgtggacacgcatgacctccgcttcccttgggtcgccttcttcgct
agcaagaggatacgagctggcacggagctgacgtgggattacaactatgaagtgggcagc
gtggaaggcaaagagctgctgtgctgctgcggggccatcgagtgccgagggcggctgctg
tga

DBGET integrated database retrieval system