KEGG   Apteryx australis mantelli (brown kiwi): 106495649Help
Entry
106495649         CDS       T04298                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04210  Apoptosis
aam04625  C-type lectin receptor signaling pathway
aam04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:aam00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    106495649 (MAP3K14)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    106495649 (MAP3K14)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    106495649 (MAP3K14)
   04672 Intestinal immune network for IgA production
    106495649 (MAP3K14)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     106495649 (MAP3K14)
Protein kinases [BR:aam01001]
 Serine/threonine kinases: STE group
  Other
   106495649 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 106495649
NCBI-ProteinID: XP_013811614
LinkDB All DBs
Position
Un
AA seq 944 aa AA seqDB search
MAVMGITCQGAPDPNIKHKKELTATKGLNETVSEKQSSVCKVEDSKKVAFHSPWKILNDV
ITKGTAKEETEGGSASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGKMAPTCWRGRHRGKSRKKRHKKRSKLKIQTVAAGRRGPRTPEQESCTPIPVQED
ETHQSTLYRNNFWVSELGKDLVYDPLLFEKPGKVLSAGKLHSPRSQYKAELHKLISPVQC
LNHVWKRHYQRDSVPQPETLHPFPYNIIPPHFPPLDSPLHAMKLNALGTYFRGDFNYQDS
EHRLSGLNLECSFPRCVNQSMKTSSDKISVEEYLVDALKGSVSLGEPQNLASLAKTWRGG
GLDLKEQFQEADENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTG
FQCAAKKVQVEHFRAEELTTCAAITSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQ
SGCLPEDRALSYLGQALEGLEYLHAQNILHGDVKADNVLLSDDGSRALLCDFGHSAHLHP
DGLGKCLITGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHP
LCLKIAKEPPPLREIPPSCNPLTAEIIKMGLEKEPVQRASASELKTKTTVALEEVGGVTS
PWKGEYREPRHLALNKENNQQTSLSPTVSPVSETDSDPKLAVKVSCASPVLPPPSLEQTE
EVEGTPWNLCKELSGIWDPPPLSSLAPLPLKSFSHAERATTISEQELQQLEIELFLNSLS
QPYSLEEQEQMLSCLSIDSPFVSDASEKNSLKASHSLRDTMSSGIHSWNSQTDGQSFSWN
NLLNRSRHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVT
KEGQPVHYDMEVPDSGIELQCTLAPDCSVSWTWRVKHGQLENRP
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattacatgccaaggagctcctgacccaaacatcaagcacaagaag
gagctcacggctacaaaggggctgaatgagacagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcaaagaaggtcgcctttcacagtccttggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctctgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaagagttcagccctactttatcagagagatccttc
attgctcatagtaagcgttacagccggtcagacagtcttgatcaaatccctaacaatgtg
gctcacgcgacggaggggaaaatggcacctacctgttggagggggaggcatcgtggtaaa
agcagaaagaaacgtcataagaaaagatccaagctgaaaatacaaacagtggccgctggc
aggcgtggtcccagaactccagaacaagaaagctgcaccccaattccagtccaggaggat
gaaacacaccaaagtactctctacagaaacaatttttgggtttcagaacttggcaaggat
ttggtctatgatccgctgctgtttgagaaacctgggaaagttctgtccgcaggcaaactc
cattcaccaaggagtcagtacaaagcagaactgcacaagctgattagccctgttcagtgc
cttaatcatgtttggaaacgtcactatcagagggacagcgttccacagcctgaaacgctt
catccttttccatacaacataatacctcctcatttcccacctctggacagtcctctccat
gccatgaaacttaatgctctgggaacatacttccgtggtgacttcaattatcaagacagt
gagcatcgcttatctggcctaaacttagaatgcagtttccccagatgcgtcaaccagtcc
atgaaaaccagttcggacaagatttctgtggaagaatacttggtagacgccttgaagggg
agcgtgagtctcggtgaaccgcaaaatttagccagcctagccaagacgtggagaggaggc
ggtctggacctgaaggaacaattccaagaagcagatgaaaatgaaggcgtgctccttaat
gagaaactaaagccagtggattacgagtaccgagaagaggttcactggaccaagtgtcac
ggttctttgggcattggttcttttggagaagtatacaaaatagaggacaagcagacagga
tttcagtgtgctgccaaaaaggtacaagttgaacacttccgtgcagaggagttaacaaca
tgtgctgcaataacaagtcctaaagttgtccccttgtatggagcagtgaaggaagggcct
tgggtgactatcttcatgaagctgatggagggtggctctctgggtcagctgattaaacag
agcggctgcctgccagaggacagagctcttagttatctgggccaagctttagagggcttg
gagtatcttcatgctcaaaacattcttcatggagatgtaaaagcggacaatgtgctctta
tctgatgatggaagcagggctcttctctgtgattttggtcactctgctcaccttcatcca
gatggcttgggaaagtgcttgatcacagggaactatgtacctggcacagagactcacatg
gctccagaggtggtcatgggaaagcgctgtgactctaaagtggatgtctggagcagctgc
tgtatgatgctgcacatgctcaacgggtgccacccttggacccagtattacaatcatcct
ctctgtctaaagatagctaaagagccacctcctctgagggaaattccgccttcctgcaac
cctctcactgctgagattattaaaatgggtctggagaaagagcctgttcagagagcatct
gcatctgaactgaaaactaagaccacagttgcacttgaagaagtgggaggtgtgacaagc
ccctggaaaggtgaatacagagagcctagacatctagctttgaacaaagaaaacaatcaa
cagacctccctgtcccccacagtgagcccagtttctgagactgattctgacccaaaattg
gcagtcaaagtttcttgtgcaagcccagtcctaccgccaccatctctggagcaaacagag
gaggtcgagggaaccccttggaacctgtgcaaggagttatctgggatctgggatcctcca
cctctctcttcattggctcctctgcccctgaagagcttcagccatgcggagagagcaaca
accatttcagaacaagagctgcagcagctggaaatagaactgttcttgaacagcctgtca
cagccttactcgctggaagagcaagaacaaatgctttcatgtctcagtatcgacagccct
tttgtgtcagatgccagtgagaagaactccctgaaggcctctcatagcttgagggacacc
atgagctctgggattcattcctggaacagccagacagatggacagagtttcagttggaac
aacctgctgaatcgcagtcgacacacggacactcccagctatttcaatggagtaaaaatc
cagattcagttgctaagtggagaaaatctacacatcagggatttccacaggacaaaggtg
ggagacattgccactgggataagcagccagataccggtccctgctttcagtctggtgacg
aaagaaggccagccagttcactatgacatggaggtcccagactctggtattgagttgcag
tgcaccctcgcccctgactgcagcgtcagctggacatggagagtcaagcatgggcaactg
gagaacaggccatga

DBGET integrated database retrieval system