KEGG   Anoxybacillus amylolyticus: GFC30_671Help
Entry
GFC30_671         CDS       T04397                                 

Definition
(GenBank) copper/zinc superoxide dismutase family protein
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aamy  Anoxybacillus amylolyticus
Brite
Enzymes [BR:aamy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GFC30_671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
648670..649188
Genome map
AA seq 172 aa AA seqDB search
MFRKVGVLAVAITLISGCQEGNPTEINVKMVNSAGDVLGTAKLSEQPKGVKISLDLEGLP
PGEHAIHIHEKGMCKKPDFQSAGNHYNPEGKKHGLLHPEGAHAGDLPNLIVKEDGTVRTE
LFAPQVTLKEGKGTLLTKEGTALVIHAGKDDGMTQPAGDAGGRIACGEIKKS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaaaagtaggtgtattagcggtggcaatcacgctaatcagtggctgccaagaa
gggaatccaaccgaaataaatgtaaaaatggtgaatagcgcgggagatgtattaggaact
gcgaaattgtcggagcagccaaagggggtaaaaatttccttggacttagaaggattgccg
ccgggagagcatgcgattcacattcatgagaaaggaatgtgtaaaaaaccagattttcaa
tcagcaggaaatcattataatccagaaggaaaaaaacatggtctattgcatccggaaggg
gctcacgcaggtgatttaccgaatttgattgtgaaagaagacggaacggtaaggacagag
ctttttgcgccgcaagtgacattgaaagaaggaaaaggcacattgttaacgaaagaaggt
accgcattagtcattcatgcgggcaaagatgacggcatgacacagccagcaggggatgca
ggtggccgcattgcgtgtggggagattaaaaaaagctag

DBGET integrated database retrieval system