KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0548Help
Entry
ANH9381_0548      CDS       T01651                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Brite
Translation factors [BR:aao03012]
 Eukaryotic Type
  Elongation factors
   ANH9381_0548
 Prokaryotic Type
   ANH9381_0548
Mitochondrial biogenesis [BR:aao03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ANH9381_0548
Exosome [BR:aao04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ANH9381_0548
  Exosomal proteins of breast cancer cells
   ANH9381_0548
  Exosomal proteins of colorectal cancer cells
   ANH9381_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(502874..504058)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAAWEEKILELANHLDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKPTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtgggtacaatcggccac
gttgaccatggtaaaaccactttaacagcagctatcactaccgtattggcaaaacactac
ggcggtgcagcacgtgcatttgaccaaatcgataatgcacctgaagaaaaagcgcgtggt
atcaccatcaacacttcacacgttgaatatgacaccccaacccgtcactatgcacacgtt
gactgcccgggacacgccgactatgtgaaaaacatgattaccggtgcggcgcaaatggac
ggtgctatcttagtagtagcagcaaccgacggtcctatgccacaaactcgtgagcacatc
ttattaggtcgccaagtaggtgttccttacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagttgaaatggaagttcgtgaacttctttctcaa
tatgacttcccgggcgatgacaccccaatcgtacgcggttctgcattaaaagcgcttgaa
ggcgatgccgcatgggaagaaaaaatccttgaattagcaaaccatttagatacttacatc
ccggaacctgagcgtgctatcgaccaaccgttccttcttccaattgaagatgtgttctct
atctccggtcgtggtaccgtagtaacgggtcgtgttgagcgcggtatcatccgtaccggt
gatgaagttgaaatcgtgggtatcaaaccgactgcaaaaaccaccgtaaccggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcgggtgaaaacatcggtgcattattgcgt
ggtactaaacgtgaagaaatcgaacgtggtcaggtattggcgaaaccgggttcaatcacc
ccgcacactgacttcgaatctgaagtgtacgtattgtccaaagaagaaggtggtcgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtacaactgacgtaaccggt
actatcgagttacctgaaggcgtggaaatggttatgcccggtgataacatcaaaatgacc
gtatccttaattcacccaattgcgatggaccaaggtttacgtttcgctatccgtgaaggt
ggccgtacagtgggtgccggcgtggtagctaaaattatcaaataa

DBGET integrated database retrieval system