KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1590Help
Entry
NT05HA_1590       CDS       T00929                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
aap  Aggregatibacter aphrophilus NJ8700
Brite
Translation factors [BR:aap03012]
 Eukaryotic Type
  Elongation factors
   NT05HA_1590
 Prokaryotic Type
   NT05HA_1590
Mitochondrial biogenesis [BR:aap03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NT05HA_1590
Exosome [BR:aap04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NT05HA_1590
  Exosomal proteins of breast cancer cells
   NT05HA_1590
  Exosomal proteins of colorectal cancer cells
   NT05HA_1590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1589175..1590359
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPQRAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKPTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtgggtacaatcggccac
gttgaccatggtaaaaccactttaacagcagctatcacaaccgtattagcaaaacactac
ggcggtgcggctcgtgcattcgaccaaatcgataacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacatcccacgttgaatacgacactccaacacgtcactacgcacacgtt
gactgtccaggacacgccgactatgttaaaaacatgattactggtgcggcgcaaatggat
ggtgctatcttagtagtagcagcaactgatggtcctatgccacaaactcgtgagcacatc
ttattaggtcgccaagtaggtgttccttacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagttgaaatggaagttcgtgaacttctttctcaa
tatgacttcccgggtgatgatacaccaatcgtacgtggttctgcattacaagcgttaaac
ggcgttgcagaatgggaagaaaaaatccttgaattagcaaaccacttagatacttacatt
cctgagccacaacgtgctatcgaccaaccgttccttcttccaatcgaagacgtgttctct
atctccggtcgtggtacagtagtaacaggtcgtgttgagcgcggtatcatccgtaccggt
gatgaagttgaaatcgtaggtatcaaaccgactgcgaaaactaccgtaaccggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcaggtgaaaacatcggtgcattattacgt
ggcactaaacgtgaagaaatcgaacgtggtcaagtattggctaaaccgggttcaatcact
ccgcacactgatttcgaatctgaagtgtacgtattatccaaagaagaaggtggtcgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtacaactgacgtaaccggt
actatcgagttaccggaaggtgtggaaatggttatgcctggcgataacatcaaaatgacc
gtatccttaatccacccaatcgcgatggaccaaggtttacgtttcgctatccgtgaaggt
ggccgtacagtaggtgctggcgtggtagctaaaattatcaaataa

DBGET integrated database retrieval system