KEGG   Alteromonas australica DE170: EP12_01905Help
Entry
EP12_01905        CDS       T03858                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aaus  Alteromonas australica DE170
Brite
Enzymes [BR:aaus01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EP12_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(431827..432372)
Genome map
AA seq 181 aa AA seqDB search
MKKRKITAMVGAVSLALSSASFAAHHDDDHISVVMKDLKTESSMGTVKVSDYDDDGVVFT
PNLKGLTPGIHGFHIHENGDCSATMKNGKTVLGGAAGGHFDPEATGQHKAPWSEAGHEGD
LPTLYVDESGNATQPVFAPELELEDIRGKAIMIHAGGDNYSDEPKKLGGGGPRVACGVIS
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgcaaaataaccgcaatggtaggcgcagtatcgttagcactcagttcagca
agtttcgcggctcaccatgatgacgatcatatcagtgtggtaatgaaagatttaaagacc
gagagcagcatgggcacagttaaagtgagtgactatgatgacgatggcgtggttttcacc
cctaatcttaaagggttaacccccggcattcatggctttcacatccacgaaaatggcgac
tgctcagccaccatgaaaaatggtaaaacggtacttggaggcgctgcgggtggtcatttc
gaccccgaagcaaccggccagcataaagccccttggtcggaagcgggtcatgaaggcgat
ctacccactctatacgtggatgaaagcggcaatgccacgcaacctgttttcgccccagag
ttagaacttgaagacattcgcggcaaagccatcatgattcacgcaggtggcgataactat
tcagatgagccgaaaaaacttggcggtggcggtcctcgtgtagcatgtggcgttatttca
gaatag

DBGET integrated database retrieval system