KEGG   Alteromonas australica DE170: EP12_16135Help
Entry
EP12_16135        CDS       T03858                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
aaus  Alteromonas australica DE170
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaus00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EP12_16135
  Lipid metabolism
   00600 Sphingolipid metabolism
    EP12_16135
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EP12_16135
Enzymes [BR:aaus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EP12_16135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3556388..3559105
Genome map
AA seq 905 aa AA seqDB search
MLFIRNYKGLLALTMLLLATNVTASQREKIDLTGEWRFYRYADNQTPDSLIYDTRPNVHQ
FNDSQAADTRPSDAITVNSQDGVLKPWILPTGNAFIANPNKRHIRPEGEPGKDFPFVQKA
FDDSHWKVVNLPHDWAIAGPFYSGNNPKVGGGMGRLPSHGVAWYRKQFTLANDDKNKRIY
LHIDGAMSYSMVWLNGHLVGGWPYGYSSYQLDLTPYVTVGQTNQLAIRLDNPPKSSRWYP
GGGIYRNVWLEKTAQIHVSQWGTQVITPTVSKDKAMISITTSIRNHTKNNQNVSLQHHIY
ELSTQDTLSEKPVLKLPSQALTLASGEEQKSQATSVLKNPKLWGPIPHQTPHRYAVVTSV
IQNGKTLDQYTTPFGVRKLAFNPDTGVVVNGEHIPLQGVNQHHDLGALGAAFNLRAAQRQ
LNILQEMGVNAIRMAHNPPAPELLTLTDKMGILVLNESFDSWYKKKTPLDFHLIFADWHE
QDLRALVRRDKNHPSVIMWYIGNEVGEQYTGEEGAEIALKLKSIVKSEDPTRPVTASMNW
AKADFPFSAAMDVISLNYQGEGIRQEPEFKNTDRIRTPPSYPAFREAHPDKVILSSETAS
AYSSRGLYFFPVTPKTSAPVRDGLGGNSKIHQVSSYELHAVDFGASADKVFRYLDTYPFV
AGQFVWNGFDYLGEPTPYYAARSSYSGMIDLAGFKKDRFYLYQSEWRPDLPMAHILPHWN
WPGREGEITPIHVFTSGDEAELFINGQSQGKKKKGPFEYRLRFDDVRYTPGTVEVVAYKN
GKRWATDSVTTSGAPSGLRLSADRNIINADGKDLSFVTVDIIDKKGNPVPTATHRVHFSL
TGPGRIVATDNGDSTNFTPFPSHERKAFSGKLLVIIQSEHNKPGELKLTASSQALEPAVL
TLRAN
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgctatttattcgcaattataaggggctgcttgcccttaccatgctactgttagccacg
aatgttacagccagccaacgagaaaaaattgatcttactggagaatggcgattttaccgc
tatgccgataatcaaacgcctgatagtttgatttacgacactcgccccaacgttcaccag
tttaacgacagtcaagcggcggatactcgcccttccgatgcgataacagttaatagccaa
gatggcgtattaaaaccctggattctccccacgggaaatgcgtttattgctaaccccaat
aagcgtcatataagacccgaaggggaaccaggcaaagattttccatttgttcagaaagcg
ttcgatgacagccattggaaagtggtgaatttacctcatgactgggccatcgctggacca
ttctatagtggcaacaaccctaaagtgggtggcggtatgggtcgtctaccctcccatggg
gtggcgtggtatagaaagcagtttacgcttgctaatgacgataaaaataaacgcatttat
ctgcatatagacggcgcaatgtcttactcaatggtatggttaaatggccatcttgtcggg
ggctggccttatggctatagctcttatcaacttgatcttacgccctatgtcactgttgga
caaaccaatcaacttgctattcgacttgataacccgccgaaatcttctcgctggtatccc
ggcggcggtatctatcgaaatgtatggttagaaaaaaccgcacagattcatgtcagtcag
tggggaacgcaggtgatcacacctaccgtgtctaaggacaaggccatgatatcgattacc
acatcaatcagaaatcatacgaaaaataatcagaacgtgagtcttcaacatcatatttat
gagctttcaacgcaagatacccttagcgaaaagccggtattaaagcttccttcccaagct
ttaacgttagcttctggagaagaacaaaaaagccaagcgacttctgtgttaaagaacccc
aagttatgggggcctataccccatcaaacaccccatcgctatgcagtggttacgtcagtc
atacagaatggaaaaacacttgaccaatacaccacgcccttcggtgttcgcaagttggcg
ttcaaccctgataccggcgtggtcgtcaatggtgagcacattccgctacaaggtgttaac
cagcaccatgatttgggcgccctgggcgctgcatttaatttgcgggccgcccagagacaa
ttaaacattcttcaggaaatgggggtaaacgctattcgcatggcacataatcctcccgcg
cccgaacttctgacgttaacggataaaatgggaattctagtattaaacgagtcgttcgac
agttggtacaagaaaaagacaccacttgattttcaccttatttttgccgattggcatgaa
caagatcttcgcgcgctagttcgacgcgacaagaaccatccttcggtgatcatgtggtat
atcggtaatgaagttggagaacaatataccggagaagaaggggctgaaatcgccttaaaa
ctaaaaagtattgttaagagtgaggaccccacccgccctgttactgcatctatgaattgg
gctaaggctgatttcccgtttagcgcagctatggacgtaataagcctaaactatcaaggg
gaaggcatccgccaagagcctgagtttaaaaataccgaccgtattcgcactcccccctct
tatcccgcttttcgcgaagcacaccccgataaagtaattttatctagtgaaacagcctcc
gcttacagctctagagggctttacttctttcctgttacaccgaaaaccagtgctccggtt
cgcgatggtcttggtggaaattcaaaaattcatcaagtcagtagctacgagctacatgcc
gtagattttggggcatcagccgataaagtttttcgctatctagatacctacccttttgtt
gctggccagttcgtatggaatggttttgattacctaggtgaacccacgccctactatgcc
gcgcgaagctcttattccgggatgatcgacctggctggtttcaaaaaggatcgcttctac
ctctatcagagcgaatggcgaccggatctgcctatggctcacattcttccccattggaat
tggcccggtagagagggagaaatcacccctattcatgtgtttacctccggagatgaagca
gagctatttattaatgggcaatcccaagggaagaaaaagaaaggcccctttgaatatcga
cttcgctttgatgatgttcgctacacgccaggaacagtagaagtagttgcctataagaac
ggcaagcgatgggcaaccgacagcgtaacaacttctggcgccccctcgggtttacgttta
tccgcagatcgcaatatcatcaatgccgacggaaaggatctatcatttgttaccgttgat
atcatagataaaaagggtaatccagtacccactgcgactcaccgcgttcacttttctctc
actgggcctggccggatagtcgcaacagataatggagattcgacaaacttcactccattt
ccttctcacgaaaggaaggcgtttagtggaaagctacttgttatcattcaaagtgagcac
aacaagcctggagaattaaagcttaccgcgagcagccaagctttagagcctgcagtcctg
acactgcgtgcaaactaa

DBGET integrated database retrieval system