KEGG   Alteromonas australica DE170: EP12_17955Help
Entry
EP12_17955        CDS       T03858                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
aaus  Alteromonas australica DE170
Brite
Translation factors [BR:aaus03012]
 Eukaryotic Type
  Elongation factors
   EP12_17955 (tuf)
 Prokaryotic Type
   EP12_17955 (tuf)
Mitochondrial biogenesis [BR:aaus03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    EP12_17955 (tuf)
Exosome [BR:aaus04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EP12_17955 (tuf)
  Exosomal proteins of breast cancer cells
   EP12_17955 (tuf)
  Exosomal proteins of colorectal cancer cells
   EP12_17955 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3987211..3988395)
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKTYGGSAQAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLNEYEFPGDDLPVIQGSALKALE
GDAEWEKKIIELGEALDSYIPEPERAIDKPFILPIEDVFSISGRGTVVTGRVEQGIVKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLAKPGSIT
PHVNFEAEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGAVELPEGVEMVMPGDNLKFK
VELIAPIAMEEGLRFAIREGGRTVGAGVVSKILD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttgaacgtacgaaaccccacgtaaacgtgggtactatcggccac
gttgaccacggtaaaactacgctaactgcagctatcactacagttctttctaaaacttac
ggcggttctgctcaggctttcgatcaaatcgataacgcgcctgaagagaaagcacgtggt
atcaccatttctacttcacacgtagagtatgacactcctactcgtcactacgctcacgta
gactgcccaggacacgctgattacgttaaaaacatgatcaccggtgctgctcagatggac
ggtggtatcctagtagttgctgcgactgatggccctatgcctcagactcgtgagcacatc
ctacttggtcgtcaggttggtattccttacatcatcgtattcatgaacaaatgtgacatg
gttgatgatgaagagcttctagagctagtagaaatggaagttcgtgaacttcttaacgaa
tacgaattccctggtgatgaccttccagttatccaaggttctgcacttaaagcccttgaa
ggcgacgcagaatgggaaaagaaaatcatcgagcttggtgaagcgcttgattcatacatc
ccagagccagagcgtgcaatcgataagccgttcattcttccaattgaagatgttttctca
atctcaggccgtggtactgttgtaacaggtcgtgttgagcaaggtatcgttaaagtaggt
gaagaagtagaaatcgttggtatcaaagatacaactaagacgacttgtactggtgttgag
atgttccgtaagcttcttgacgaaggccgtgctggtgagaacgttggtgttcttctacgt
ggtactaagcgtgacgaagttgaacgtggtcaagtactagctaagcctggttcaatcacg
ccacacgttaacttcgaagcagaagtatacgtactgtctaaagatgaaggtggtcgtcat
actccattcttcaagggttaccgtccacagttctacttccgtacaactgacgtaactggt
gctgtagagcttccagaaggcgtagaaatggtaatgcctggtgacaaccttaaatttaaa
gttgagctaattgctccgattgcgatggaagaaggtcttcgtttcgcaatccgtgaaggt
ggtcgtacagtaggtgctggtgttgtatctaagatcctagactaa

DBGET integrated database retrieval system