KEGG   Altererythrobacter atlanticus: WYH_02797Help
Entry
WYH_02797         CDS       T03925                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aay  Altererythrobacter atlanticus
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aay00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    WYH_02797
Enzymes [BR:aay01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     WYH_02797
Transporters [BR:aay02000]
 Other Transporters
  Pores ion channels [TC:1]
   WYH_02797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2907980..2908651
Genome map
AA seq 223 aa AA seqDB search
MWQLYHFPLCPFSRKVRLALSEKGVTHELTLVYPWQAGDAFFALNPAGRTPVVYQPEKKL
TLIDSQAICEYFEETVDKSPLILGTAAGRAEIRRLTALFDEQFFADVTAPLMFEKMKKRL
VYRQPPDSQALRTAMRLAHEHLDYIDWLTDTRRWLAGAQLSLADFAAAAQISVADYLGGI
DWSGHDSAHSWYRVMKSRPSFRPLLAEKMEGIPPPRHYADVNA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaactctatcacttccccctctgtccgttcagccgcaaggtgcgcctcgccctt
agcgagaagggcgttacccacgaactgacgctggtttatccctggcaggcaggcgatgcc
ttcttcgcgctgaacccggcaggccgtaccccggtggtgtatcagccggaaaagaagctg
acgctgatcgacagtcaggcgatctgcgaatattttgaagagacggtggacaagagcccg
ctgatcctcggtacggcggctggccgcgcggaaatccgccggttgacggccctgttcgat
gaacaattcttcgccgatgtcaccgcgccgctgatgttcgaaaagatgaagaagcggctc
gtctatcgccagccgccggattcgcaggccctgcgcacggccatgcggctggcgcatgaa
catctggattatatcgactggctgaccgatacccgccgctggctggccggggcgcaattg
agcctcgctgatttcgccgccgccgcgcagatttccgtcgccgattatctcggcggaatc
gactggtccggccatgacagcgcgcatagctggtaccgggtgatgaaaagccggccaagc
ttccgcccgctgctggcggaaaagatggaaggcatccccccgccgcgccattatgccgac
gtgaacgcctga

DBGET integrated database retrieval system