KEGG   Altererythrobacter atlanticus: WYH_02889Help
Entry
WYH_02889         CDS       T03925                                 

Gene name
geoB
Definition
(GenBank) Geranial dehydrogenase
Organism
aay  Altererythrobacter atlanticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3001893..3003365
Genome map
AA seq 490 aa AA seqDB search
MTPEGVNIKHPDKLFIGGEWVAATSGTQIELSSPATEEVVGRVAEASNADMDKAVAAARE
AFDNGPWPNTPPAERGRKLMEMADVLEKRVPEMAAAWTAQVGGLASFAPMMHGGAVAQLR
GIAALGESFDWVTQQKGQVVDTAIVAREPVGVVVGIAPWNAPFGIMANKVFYALIAGCPI
IMKPSPETPLETYIIAEAAEAVGLPAGTVNLVPSGRDAADHLIHSPDIDKVTFTGSSAAG
MHIAGVCGSKMTRCTMELGGKSAAIVRDDFPIEAAAGILGNTITVMSGQVCAMLSRAIVT
KDRHDELAEAIAGVMKGIRIGTPDDPETQLGPLAMKRQLERVEMYIEEGRKSGADLVTGG
SRPAHMNKGYYMEPTLFANVDNTSRIAQEEIFGPVLCLIPAEDEEDAIRIANESNFGLNG
SVFTNDPQAAYDISRKVRTGVMGQNGMRMEFGMPFGGFKQSGMGREGGPEGLWPYLETKT
ILLDGAPSQL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaaggcgtaaatatcaagcatccggacaagctgttcatcggcggcgaatgg
gtcgccgcgaccagcggcacccagatcgagctgtcgagcccggccacggaggaagtcgtc
ggccgggttgccgaagccagcaatgcggacatggacaaggccgtggccgccgcgcgcgaa
gctttcgacaatggcccctggcccaacaccccgcctgccgaacgcggccggaagctgatg
gaaatggccgatgtgctggaaaagcgcgtgccggaaatggccgccgcgtggacggcgcag
gtcggcggcctggccagtttcgccccgatgatgcatggcggcgccgttgcgcaattgcgc
ggcatcgcggcactgggcgaaagcttcgactgggtcacccagcagaaggggcaggtggtc
gataccgccatcgtggcacgtgaacccgttggcgtggtggtcggcattgcgccgtggaat
gcccccttcggcatcatggccaacaaggtgttctacgcgctgatcgcgggttgcccgatc
atcatgaagccttcgcccgaaacgccgctggaaacctatatcatcgccgaagcggcggag
gccgtggggctgccggccggcacggtgaacctggtgcccagcggccgcgatgctgccgat
cacctgatccacagcccggatatcgacaaggtcaccttcaccggctccagcgcggcgggc
atgcatattgccggcgtctgcggcagcaagatgacccgttgcacgatggaactgggcggc
aagtccgccgcgatcgtgcgcgatgatttcccgatcgaggcggccgcgggcatcctcggc
aacacgatcacggtgatgagcgggcaggtctgcgccatgctcagccgcgccatcgtgacc
aaggaccggcatgacgaactggccgaagcgattgcgggcgtgatgaagggcatccgcatc
ggcacgccggacgatccggaaacgcagcttggcccgctggccatgaagcgccagcttgaa
cgcgtggaaatgtatatcgaggaaggccgcaagagcggtgccgatctcgtcaccggcggc
agccgtccggcgcatatgaacaagggttactatatggaaccgaccctgttcgccaatgtc
gacaataccagccgcatcgcccaggaagaaatcttcggccccgtgctctgcctgataccg
gcagaggacgaggaagatgccatccgcatcgccaacgaaagcaatttcggcctcaacgga
tcggtcttcaccaatgatccccaggctgcctatgacatcagccgcaaggtccgcaccggc
gtgatggggcagaacggcatgcgcatggaattcggcatgccctttggcggcttcaagcag
tccggcatgggccgtgaaggcgggccggaaggcctgtggccctatctcgaaaccaagacc
atcctgctggacggggcgccgtcgcagctttga

DBGET integrated database retrieval system