KEGG   Candidatus Koribacter versatilis: Acid345_4468Help
Entry
Acid345_4468      CDS       T00352                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aba  Candidatus Koribacter versatilis
Brite
Enzymes [BR:aba01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Acid345_4468
Peptidases [BR:aba01002]
 Metallo Peptidases
  Family M2
   Acid345_4468
Exosome [BR:aba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acid345_4468
CD molecules [BR:aba04090]
 Proteins
  Acid345_4468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
5301446..5303317
Genome map
AA seq 623 aa AA seqDB search
MRRPHYDASTAACTIPAGGTMLRKAFLTAVLTAAIVPLSVFAQSTPTVADAEKFVKDAET
KLDDLGVKAQRAEWVAENFITDDTQEIAAEANEIANAEATNFAKQTIQFEKLQLPPELAR
KMLLLKLAAIAPSNPKDLSELTRVQASMAADYGKGKYCPTTGKHAGECLDITKIEHIMET
STDPDELKDLWIGWHKVGAPMRQRYARFVELSNNGAREMGWADTGAYWRAGYDMPPDQFS
AELERLWQQMRPLYVSLHTYVRNQLVKKYGEQAVKDGMIRADLLGNPWAQEWGNIYPLVA
PPTKHPQLDVTQILQDRKVDELGIVHYGENFFKSLGFPALPQTFWERSLFLKPKDRDVIC
HASAWDIDNKDDLRIKTCLQVRADDFVTVHHELGHNFYQRAYKAQSPLFENGANDGFHEA
IGDTIALSITPEYLKQVGLIDTVPQQDDVALLLRQALDKVAFLPFGLLIDQWRWKVFNGQ
IKPEDYEKSWVQMREHYQGVYPPTDRTEADFDPGAKFHVPANVPYTRYFLARVLQFQFYR
AMCKEAGFTGPLHQCSFYNNKKAGAKLDAMLEMGASKPWPEELKVLTGEDKMDAGAMLDY
FAPLKKWLDEQNKGQQAGWTEQK
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgacctcactacgacgcgagcaccgccgcttgtacaattcccgccggaggtacc
atgctgcgaaaagcattcctaactgctgtccttactgctgcaatcgttccgctttctgtg
ttcgcgcaatccactcccaccgtcgccgacgccgaaaagttcgtgaaagacgccgagacc
aagctcgacgacctcggtgtaaaagcccagcgcgctgagtgggtcgcggaaaacttcatt
accgacgacacccaggaaatcgcggccgaagccaacgagatcgcgaacgctgaagcgacg
aacttcgccaagcagacgatccagtttgagaagctgcaactcccgccggagttggcgcgc
aagatgttgctcctcaaactcgcggccattgcgcctagcaaccccaaagacctctcggaa
ctgacccgggtgcaggcctcgatggccgccgactacggcaagggcaagtattgccccacc
accggcaagcacgccggcgagtgcctcgacatcaccaagatcgagcacatcatggaaacc
tccaccgatcccgacgaactgaaggacctctggatcggctggcacaaggtcggcgcaccc
atgcgccagcgctatgcgcgcttcgtcgagctcagcaataatggtgcccgcgaaatggga
tgggccgacaccggcgcctactggcgtgccggctacgacatgcctcccgaccagttcagt
gctgagttggaacggctgtggcagcagatgcgtccgctgtacgtttctctgcacacctac
gtccgcaaccagctggtaaagaagtatggggagcaggccgtgaaagacggcatgatccgc
gccgacctcctcggcaacccctgggcccaggagtggggcaacatctaccccctcgtcgcc
ccgcccaccaagcatccgcagctcgacgtcacccagattctgcaagacagaaaagttgac
gagctcggcatcgttcactacggcgagaatttcttcaaatcgctgggcttcccggcgctg
ccgcaaactttctgggagcgctctctcttcctgaaaccgaaagaccgcgacgtaatctgc
cacgccagcgcatgggacatcgacaacaaagatgacctccgcatcaagacctgtctccag
gttcgcgccgatgacttcgtcactgtccaccacgaacttggccacaacttctatcagcgc
gcctacaaggcccagtcgccgcttttcgagaacggcgccaacgacggcttccacgaggcc
attggcgacaccatcgcgctctccatcacgccggagtacctgaagcaggtcggcctcatc
gacaccgtcccgcaacaggatgatgtcgctctgctgctgcgccaggcgctcgataaggtc
gcgttcctacccttcggattgctgatcgaccagtggcgctggaaggtcttcaacgggcag
atcaagccggaagactacgagaagtcgtgggtgcagatgcgcgagcactaccaaggcgtc
taccccccgaccgaccgcaccgaagccgacttcgatccgggcgcgaagttccatgtgccg
gcgaacgtcccgtacacgcggtacttcctcgcgcgcgttttgcaattccagttttatcgc
gcgatgtgcaaagaggccggattcaccggtccgctgcaccagtgctcgttctacaacaac
aagaaagccggcgcgaaactggatgccatgcttgagatgggcgccagcaagccctggccg
gaagagctcaaagtcctgaccggcgaagacaagatggacgccggggccatgctcgattac
ttcgcgccgctaaaaaaatggctcgacgaacagaacaaggggcagcaagccggctggact
gaacagaagtaa

DBGET integrated database retrieval system