KEGG   Luteitalea pratensis: LuPra_00689Help
Entry
LuPra_00689       CDS       T04394                                 

Gene name
aldHT_1
Definition
(GenBank) Aldehyde dehydrogenase, thermostable
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
abac  Luteitalea pratensis
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:abac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LuPra_00689 (aldHT_1)
Enzymes [BR:abac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     LuPra_00689 (aldHT_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(792717..794162)
Genome map
AA seq 481 aa AA seqDB search
MSAYQNLIAGQWAPSATGRTFENRNPADVDDLVGTFPESSADDVAAAVVAARAAQPAWAA
MPAPKRGDVLYRAANLLEARADAVAREMTREEGKTLPEAKGEVGRAINILRYYGGEGARL
YGRVIPSERDRVFMHTLRTPLGVIGAITPWNFPIAIPAWKSCPALISGNAVVLKPSELAP
LCATRLAEILVEAGLPAGVLNVVHGSGEAGSALVAHEQVRAISFTGSEATGSKVADVCGK
RRARVQLEMGGKNPTIVLADADLDEAAGIVLNAAFGSTGQRCTATSRAIVERSVADAFSE
KLVTKAKAMKVGPGLEAGIDVGPSINAAHADRVVTEVAAAAGAGAQVLAGGTRLTDGALG
RGHFVAPTVLGGVTPTMTIAQEEVFGPVAAVLSADDFEHALAIANDVRFGLSATICTRSL
SHALQFAQRIEAGLVMVNLPSAGVEYQVAFGGSKASSLGPREQGPEAIDFYTTLKTVYMK
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgcctaccagaacctcatcgccggccagtgggcgccctccgctacgggccgcacg
ttcgagaaccgcaaccctgccgacgtggacgacctcgtcgggacgttccccgaatcgtcg
gccgacgacgtcgcggctgccgtcgtggcggcacgggccgcgcagccggcgtgggccgcg
atgcctgcaccgaagcgcggcgacgtgctgtaccgcgccgccaacctgctggaagcccgc
gccgacgccgtcgcccgcgagatgacccgcgaggaaggcaagacgctgcccgaggcgaag
ggcgaagtgggccgggccatcaacattctccgctactacggtggtgagggcgcgcggctc
tacggacgcgtcatcccctccgaacgcgaccgcgtcttcatgcacacgctgcgcacgccg
ctgggcgtgatcggcgcgatcacgccgtggaacttccccatcgccattcccgcgtggaaa
tcctgcccggcgttgatcagcggcaacgcggtggtgctcaagccatccgagctcgcgcct
ctgtgcgccacgcgcctggccgagatcctcgtcgaggccggcctgcctgccggcgtgctc
aacgtcgtgcacgggagcggggaggcaggcagcgcactcgtcgcgcacgagcaggtccgc
gcgatctcgttcaccgggtccgaggcgacaggcagcaaggtcgccgacgtgtgtggcaag
cggcgcgcgcgggtgcagctcgagatgggcggcaagaacccgacgatcgtgctcgccgat
gccgacctcgacgaggccgccggcatcgtcctcaacgcggcgttcggatcgaccggacag
cgctgcaccgccacgtcacgcgcgatcgtcgagcgctcggtggccgacgccttcagcgag
aagctggtcaccaaggcgaaggccatgaaggtggggccgggcctcgaggcgggcatcgac
gtcgggccgagcatcaatgccgcacatgccgatcgggtcgtcaccgaagtcgccgcggcg
gccggcgcgggtgcgcaggtactcgccggtggcacacggctcaccgacggcgcgcttggc
cggggtcacttcgtcgcccccaccgtgctcggcggcgtgacgccgacgatgaccatcgcg
caggaggaggtcttcgggccggtggccgcggtcttgtctgccgacgacttcgagcacgcc
ctcgccatcgccaacgacgtgcgcttcggcctctcggcgaccatctgcacgcggtcgctg
tcgcacgcgttgcagttcgcgcagcgcatcgaagccgggctggtgatggtgaacctgccg
tcggcaggcgtcgagtaccaggtcgcgttcggtggatcgaaggcgagttcgctcgggccg
cgggaacagggacccgaggccatcgacttctacacgacgctgaagacggtgtacatgaag
tactga

DBGET integrated database retrieval system