KEGG   Acinetobacter baumannii D1279779: ABD1_05990Help
Entry
ABD1_05990        CDS       T02491                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
abad  Acinetobacter baumannii D1279779
Brite
Enzymes [BR:abad01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     ABD1_05990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGH34490
LinkDB All DBs
Position
673954..674574
Genome map
AA seq 206 aa AA seqDB search
MIDLYYWGTPNGHKITIALEEMGLDYTLYPINILENDQFQPDFLKISPNNKIPAIVDQDG
PRGEPISVFESGAILQYLGRKTGLFYPTDEQERVEVEQWLMWQMGGLGPMLGQNHHFNRF
APEKIPYAIDRYVNETKRLYGVLNKQLIGQKFVAGEYSIADMAILPWILRYEWQGIQLED
YPYVQEYIVRLTARPAVQKALSIKVI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattgatctatattattggggcacacccaatggacataaaatcacaattgccttagaa
gaaatgggactggattacaccctttacccaattaatattttagaaaatgatcaatttcaa
ccagacttcctgaaaatttctccgaataataaaattcctgccattgttgaccaagatggt
ccacgtggtgagccaatttcagtatttgaatcaggcgcgatcttgcagtatttaggacga
aaaactggattgttctacccgacagacgagcaagagcgagttgaagtggaacaatggctt
atgtggcaaatgggtggcttaggtcctatgttgggacaaaatcatcattttaaccgcttt
gcgccagagaaaattccctatgctatagaccgctatgtaaatgagactaagcgtttatat
ggtgtgttgaataaacagctcattggtcagaagtttgttgcaggggaatactcaattgct
gatatggcaattctaccttggattttgcgttatgaatggcaggggattcaattagaggat
tacccgtatgtacaagaatacattgttcgcttaaccgcacgccctgcagtacaaaaagca
ttatcaattaaagtcatctaa

DBGET integrated database retrieval system