KEGG   Acinetobacter baumannii D1279779: ABD1_23430Help
Entry
ABD1_23430        CDS       T02491                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
abad  Acinetobacter baumannii D1279779
Brite
Enzymes [BR:abad01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ABD1_23430 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2529723..2530349
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKA
TAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIDEAFGSYEKFAEEFTAA
ATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLENLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgatttagcgccacatatc
agtaaagaaactttagaataccatcacgataaacaccacaatacctatgttgttaactta
aacaacttaatcaaaggtactgaccttgaaggtaaaactttagaagaaatcattaaagca
actgctggtgatgcatctaaagctggtattttcaacaatgctgctcaagtttggaaccac
actttctactggaacagcatgaagccaaacggtggtggtaagcctactggcgcaatcgct
gctaaaattgacgaagcttttggtagctacgaaaaatttgcagaagaatttactgctgct
gcaacaactcaattcggttcaggttgggcttggttagttgctgatgaagtaaacggtaaa
ctttctattactaaaacttctaatgcagacactccacttgcacatggtcaaattgctgta
ttaacaattgacgtatgggaacatgcttactacatcgatttccgtaacttacgtcctaaa
tacatcgcaactttcttagaaaaccttgtgaactgggactatgcaaatgcaaaacttgca
ggccaaccagctggtgtagagaaataa

DBGET integrated database retrieval system