KEGG   Acinetobacter baumannii LAC-4: ABLAC_36550Help
Entry
ABLAC_36550       CDS       T03519                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
abal  Acinetobacter baumannii LAC-4
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abal00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABLAC_36550
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ABLAC_36550
Enzymes [BR:abal01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ABLAC_36550
Peptidoglycan biosynthesis and degradation proteins [BR:abal01011]
 Precursor biosynthesis
  Racemase
   ABLAC_36550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3816458..3817561)
Genome map
AA seq 367 aa AA seqDB search
MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIERVYEAFKAADGFALLD
LDEAKRIRALGWTGPILLLEGIFSPQDLFDCVQYQLSFTIHSEAQIEWVEKHPYPAQFDV
FLKMNSGMNRLGFKPQHYVQAWERLNNLANVAKITHMMHFSDADGDRFGQQGIDYQITAF
EEIVKDLPGERSVSNSAAILRYQDQLKSDYVRSGIMLYGSSPDYPTHSITDWGLQPTMSL
RSEIISVQHLEPNESVGYGSNFVAEQPMTIGIVACGYADGYQRISPTGTPVLVDSVRTRT
VGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTGVVLSIDDVAVSSGTVGYELMCAVTAR
VQFINQV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctattaccgcagtgattcaccgtcaagccttacaaaataacttggcggtg
gtacgcaaggctatgccaaacagtaaggtctttgccgttgtcaaagccaatgcttatgga
catggaattgaacgtgtttatgaagcatttaaagcagcagatggctttgccttactggat
cttgatgaagcaaaacgaattcgtgctctaggttggacgggtccgattttgttgctcgaa
gggattttttctcctcaagatttatttgattgtgtgcagtatcagcttagtttcaccatt
catagtgaagcgcaaatcgagtgggtagaaaagcatccttaccctgctcaatttgatgtt
tttttgaaaatgaacagtggtatgaaccgtcttggttttaaaccacagcattatgtgcag
gcttgggaacgtttaaataatttggcaaatgtcgccaagattacccacatgatgcatttt
tcggatgcagatggtgatcgtttcggtcagcaaggtattgattatcaaattactgccttt
gaagaaattgtgaaggatttaccgggtgaaagatcggtaagtaatagtgcggcaattctg
cgttatcaagaccagctcaaatcagattatgtccgtagcggcatcatgctttatggcagc
tcgccagattacccaacgcatagtattacggattggggcttgcagccgaccatgagctta
cgtagtgaaattatttccgttcagcatttggagccgaatgaaagcgtaggttatggctca
aactttgtcgcagagcaacccatgacgattgggattgtggcttgcggctatgccgatggt
tatcaacgtatttcgccaacaggtactccagttttagtggactcagtacgcacgcgtaca
gttggccgcgtcagtatggatatgttggcagtcgatttaacgggtattgagagtgccaaa
gttggtagtgaagtggtgctctggggtcagtcaagtacaggcgtcgttctatctattgac
gatgttgcagtttcatccggtacggtgggttatgaactgatgtgtgccgtcaccgcccgt
gttcaatttattaatcaggtataa

DBGET integrated database retrieval system