KEGG   Acinetobacter baumannii AB030: IX87_15070Help
Entry
IX87_15070        CDS       T03375                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
abau  Acinetobacter baumannii AB030
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abau00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    IX87_15070
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    IX87_15070
Enzymes [BR:abau01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     IX87_15070
Peptidoglycan biosynthesis and degradation proteins [BR:abau01011]
 Precursor biosynthesis
  Racemase
   IX87_15070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2942130..2943233
Genome map
AA seq 367 aa AA seqDB search
MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIERVYEAFKAADGFALLD
LDEAKRIRALGWTGPILLLEGVFSPQDLFDCVQYQLSFTIHSEAQIEWLEKHPYPAQFDV
FLKMNSGMNRLGFKPQHYVQAWDRLNNLANVAKITHMMHFSDADGDRFGQQGIDYQITAF
EEIVKDLPGERSVSNSAAILRYQDQLKSDYVRSGIMLYGSSPDYPTHSIADWGLQPTMSL
RSEIISVQHLEPNESVGYGSNFVAEQPMTIGIVACGYADGYQRISPTGTPVLVDSVRTRT
VGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTGVVLPIDDVAVSSSTVGYELMCAVTAR
VQFINQV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctattaccgcagtgatccaccgtcaagccttacaaaataacttggcggtg
gtacgcaaggctatgccaaacagtaaggtctttgccgttgtcaaagccaatgcttatgga
catggaattgaacgtgtttatgaagcatttaaagcagcagatggctttgccttacttgat
cttgatgaagcaaaacgaattcgtgctctaggttggacaggcccgattttattgctcgaa
ggagttttttctcctcaagatttatttgattgtgtgcagtatcagcttagtttcaccatt
catagtgaagcgcaaatcgagtggttagaaaagcatccttatccggctcaatttgatgtt
tttttgaaaatgaacagtggtatgaaccgtcttggttttaaaccacagcattatgttcag
gcttgggaccgtttaaataatttggcaaatgtcgccaagattacccacatgatgcatttt
tctgatgcagatggtgatcgttttggtcagcaaggtattgattatcaaattactgccttt
gaagaaattgtgaaggatttaccgggtgaaagatcggtaagtaatagtgcggcaattctg
cgttatcaagaccagctcaaatcagattatgtccgtagcggcatcatgctttatggcagc
tcgccagattacccgacccatagtattgcggattggggcttgcagccaaccatgagttta
cgtagtgaaattatttccgttcagcatttggagccgaatgaaagcgtaggttatggctca
aactttgtcgcagagcaacccatgacgattgggattgtggcttgcggctatgccgatggt
tatcaacgtatttcgccaacaggtactccggttttagtggactctgtacgtacgcgtaca
gttggccgcgtcagtatggatatgttggcagtcgatttaacgggcattgagagtgccaaa
gttggtagtgaagtggtgctctggggtcaatcaagtacaggcgtcgttctacctattgac
gatgttgcagtttcatccagtacggtgggttatgaattgatgtgtgccgtcaccgcccgt
gttcaatttattaatcaggtataa

DBGET integrated database retrieval system