KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_2733Help
Entry
ABTW07_2733       CDS       T01908                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Brite
Enzymes [BR:abd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ABTW07_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2908394..2909020
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKA
TAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIDEAFGSYEKFAEEFTAA
ATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLENLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgatttagcgccacatatc
agtaaagaaactttagaataccatcacgacaaacaccacaatacctatgttgttaactta
aacaacttaatcaaaggtactgaccttgaaggtaaaactttagaagaaatcattaaggca
actgctggtgatgcatctaaagctggtattttcaacaatgctgctcaagtttggaaccac
actttctactggaacagcatgaagccaaacggtggtggtaagcctactggcgcaatcgct
gctaaaattgacgaagcttttggtagctacgaaaaatttgcagaagaatttactgctgct
gcaacaactcaattcggttcaggttgggcttggttagttgctgatgaagtaaacggtaaa
ctttctattactaaaacttctaatgcagacactccacttgcacatggtcaaattgctgta
ttaacaattgacgtatgggaacacgcttactacatcgatttccgtaacttacgtcctaaa
tacatcgcaactttcttagaaaaccttgtgaactgggactatgcaaatgcaaaacttgca
ggccaaccagctggtgtagagaaataa

DBGET integrated database retrieval system