KEGG   Trichophyton benhamiae: ARB_07881Help
Entry
ARB_07881         CDS       T01611                                 

Definition
(RefSeq) fatty acid oxygenase PpoC, putative
  KO
K17862  
linoleate 10R-lipoxygenase [EC:1.13.11.62]
Organism
abe  Trichophyton benhamiae
Pathway
Linoleic acid metabolism
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    ARB_07881
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.62  linoleate 10R-lipoxygenase
     ARB_07881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 1095 aa AA seqDB search
MAGGATNGVNGVTNGTHATTNGTNGTKSSTSSPPSQSTAPRAKRGDVEGTFAKYAQLIHA
SRRPLPNQSGDGSYLREETKYTSTLSDLRTMGWKGISTLLAVRKHKKSGKLDNDREYIME
RVINLVAGLPPQSKMRKDLTNTFVKQLWDSLLHPPPTMLGDDYKYRSADGSYNNPMLPML
GAANTPYARSIIPESIQLGSLPDPGLIFDSIFAREKFKPHPNGVSSVFFNWASLIIHDLF
QTDYRNPHISETSSYLDLSILYGDNQEDQNKVRTFKDGKLKPDCYSEARLLAFPPACSVI
LIMLNRFHNYAVEQLAAINEGGRFAKPRSGMSPEATEKAWAKYDNDLFQTGRLITCGLYI
NITLYDYVRTIINLTRSNTTWSLDPRVGMREGAVPEAAASGIGNQVSMEFNLAYRWHSCI
GAADEDFTNNTYQQMFGKSGEDLSIPELVGGLGKWQASIPDDPAERTFAGLKRKTDGTFD
DGELMNIMTEAIEEVAGSFGPKNVPKALRGVEILGMQMARKWGCASLNEFRKFFGLKEYQ
TFEEINSDPEISGALRNLYEHPDHVELYPGIVAEEPKIPMVPGAGICPTYTISRAILSDA
VVLVRGDRFYTVDYHAKNLTNWGYAETHYDLSVNQGCMFYKLMLRAFPNHVKSDSIYAHF
PMTIPSEMKKVMTDLGRHDNFSWDRPAFIPPRVNITSYMGAKTILENSKDFRVTWGEATG
FLFGKGGLDFMLSGDSTFHGQQRKTMGKALYHSEWKKHIKEFYEDITIRLLREKTCKIAG
INQVDITRDIFGLPLKTAENPKGIYTEHEMFMIMCLIFTTIFFDLDPAKSFPLRQAARTV
AQQLGQIMEARVKAVKGGILSLFSRMGENKNALSQYGVHMIRRLLDSGLSVEQVTWSQVM
PTAGAMIPNQAQVFTQIIDYYLSEEGKVHLPDIKRWANEKTDEADEKLLHYCMEGIRLNG
TFGSYRESTAALDIDDDGRNVSVKPGDKVFVSFVGAARDPNIFPSPHEVRLDRPLDSYIH
YGEGPHACLGKDANMIALTSMLRVVGGLDNLRRAPGPQGELKKIPRPGGFYIYMREDQSG
YFVFPMSKLPIVQVL
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atggccgggggtgctactaacggtgtcaatggagtgacaaatggcacccatgcaactaca
aatggaacaaatggaacgaagtcgagcaccagctcacccccaagccagagcacagctcct
cgagctaagagaggagatgttgagggcactttcgcaaaatacgcccaactgattcatgcc
tctagacgccctttgcctaaccagtcaggagatggctcgtatctcagagaagagaccaaa
tataccagcactctttccgacctgcggactatgggatggaagggcatttccactttgctg
gcagtcaggaaacacaagaagagtggaaagctcgacaatgatcgagagtacattatggag
cgtgttatcaacctcgttgcaggccttccaccacaatcgaagatgcgcaaggacttgacg
aatacttttgtgaagcagctttgggactctctcctccaccctccaccaaccatgctgggc
gatgattacaagtacaggagcgcagacggatcttacaacaacccaatgcttccaatgctg
ggagcagcaaacactccttatgctcgttccataattccggagtcaatccaactaggatcc
cttcccgacccaggactcatctttgatagcatctttgcgcgtgagaaattcaagcctcac
ccgaacggagtttctagtgtcttcttcaactgggcgtctctgatcatccatgatttattc
caaactgactatcgaaaccctcacatttcggaaacttcttcgtacctcgacctctccatc
ttatacggagacaaccaagaagaccagaacaaggtgcgaactttcaaggatggtaaacta
aagcccgattgctattctgaagcacgtcttcttgccttccctccggcttgcagcgttatc
ctcatcatgttgaacagattccacaactatgctgtcgagcagctcgccgctattaatgaa
ggtggccggtttgccaaaccaagaagtggaatgagcccagaagccactgagaaggcttgg
gctaaatatgacaatgaccttttccagactggacgattgattacttgtggactatacatt
aacatcacactttacgactacgtccgtaccattatcaacctgacccgcagcaacactact
tggagtttggacccacgagttggcatgcgtgagggtgcagttcctgaagctgctgctagc
ggaattggtaaccaggtctccatggaattcaacctggcttaccgctggcattcttgcatt
ggtgctgctgatgaggacttcaccaacaacacttatcaacagatgttcggaaagagtggt
gaagacctctctattccagagcttgttggaggactgggtaaatggcaggctagcattcct
gatgacccagctgagagaacctttgctgggctcaaacgaaagactgatggcacttttgac
gatggtgaactcatgaacataatgactgaagccatcgaagaggttgctggatccttcggt
cccaaaaatgttccaaaggcactccgtggcgttgagatcctcggcatgcaaatggcccgt
aaatggggttgcgcctctctcaatgagttccgcaaatttttcggattaaaggagtatcag
actttcgaggagatcaactccgacccagagatctctggagctcttcgcaatctctacgag
catcctgaccacgttgaattgtaccccggtattgttgccgaggagccaaagattcctatg
gttcctggagctggtatctgtccaacatacactatttctcgtgccatcttgtctgatgct
gtggtgttggtccgtggagatcgtttctacactgttgattaccatgcgaagaacttgacc
aactggggttacgctgagactcactatgacctcagtgtcaaccagggctgcatgttctac
aagctcatgctcagggcattccctaaccatgtcaagagcgattcgatctacgctcatttc
ccaatgactatcccaagcgagatgaagaaggtcatgactgatctcggtcgacatgacaac
ttctcctgggaccggccggcctttattcctcctcgtgtaaacatcacctcttacatggga
gcaaagactatcttggaaaactccaaggacttccgtgtcacctggggagaggctactggt
ttcctcttcggcaagggaggactggacttcatgctttctggagacagtacgttccatggc
cagcagcgcaagaccatgggcaaggcgttgtaccacagcgaatggaagaagcatatcaag
gagttttacgaggatatcaccatcaggcttctcagggagaagacttgcaagatcgcaggc
atcaaccaggttgatatcaccagagacattttcggcttgccattgaagactgcagagaac
cccaagggtatctacaccgaacatgaaatgttcatgatcatgtgtttgatctttaccact
atattcttcgatctggaccctgccaaatccttcccgctcagacaggccgccagaactgtt
gctcagcaacttggccagattatggaggcccgtgtcaaagccgtcaagggaggtattctc
tccctgttcagccgtatgggtgagaacaagaatgccctgtcccagtacggtgtccatatg
atccgccgcctcctcgattcagggctcagtgttgagcaagttacctggtctcaggtcatg
ccaactgcaggagctatgattccaaaccaggctcaagtgtttactcaaatcattgactac
tatctctccgaggagggcaaggttcacctgccagatatcaaacgctgggccaatgagaaa
accgacgaggccgatgagaaacttctccactactgcatggaaggtatccgcttgaacggt
accttcggatcctaccgcgagtctactgcagctcttgacatcgatgatgatggccgcaat
gtgtccgtcaagcctggtgacaaggtcttcgtcagcttcgttggtgctgcccgtgatccc
aacatcttcccctcgccacatgaagtccgccttgaccgtcccttggattcatacatccac
tacggtgagggcccgcacgcctgtctaggcaaggatgcaaacatgatcgcacttacgtct
atgctgcgtgttgttggtggtctagacaacctccgccgagctccagggccccagggcgag
ctgaagaagatcccgcgtccaggtggcttctatatctacatgcgcgaggaccagagcggc
tacttcgtcttcccaatgagtaagttaccaattgtccaggttctatga

DBGET integrated database retrieval system