KEGG   Azospirillum brasilense Sp7: AMK58_02560Help
Entry
AMK58_02560       CDS       T04566                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00020  Citrate cycle (TCA cycle)
abf00310  Lysine degradation
abf00380  Tryptophan metabolism
abf01100  Metabolic pathways
abf01110  Biosynthesis of secondary metabolites
abf01120  Microbial metabolism in diverse environments
abf01130  Biosynthesis of antibiotics
abf01200  Carbon metabolism
Module
abf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMK58_02560 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    AMK58_02560 (sucA)
   00380 Tryptophan metabolism
    AMK58_02560 (sucA)
Enzymes [BR:abf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AMK58_02560 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ALJ34396
UniProt: A0A0P0E872
LinkDB All DBs
Position
complement(564738..567662)
Genome map
AA seq 974 aa AA seqDB search
MSANLEKTSFLFGSNAEYVAELYARFLKDPSSVDSSWNGFFRELDDDSRAVLNELNGPSW
SLEEGTLANGALDPVAASLDSIGAPAATNGNAGLVAHAQQVYGGISHQQLRAATLDSIRA
LMLIRVYRVRGHMNAHFDPLGLEKREPHPELDPATYGFGPGDMDRPIFLNYSLGLETASL
RQILEILQKTYCGNIGVEFMHIQDPEEKAWIQERIEGGRNHTEFTVNGKRAIYERLIAAE
GFEKFLQLKYTGTKRFGLEGGESMIPALEQVLKRGGQLGLKEVVVGMAHRGRLNMLTNFM
GKPFAAVFSEFQGNPSSPQDVQGSGDVKYHLGTSSDRDFNGNIVHLSLTANPSHLEWVNP
VVLGKVRAKQAQRNDLDREQVMGVLIHGDAAFAGQGIVAETLGLSELRGYRTGGTVHFII
NNQIGFTTNPTYSRSGVYCSDMAKMVQAPIFHVNGDDPESVVHISRIAAEFRQKFKRDVV
IDMVCYRRHGHNEGDEPGFTQPLMYKKIRAHATTRELYGKQLVEENVLTQAESDQMIQDF
MKKLEGEFEAANSFKPNKADWLEGKWSGLEAAKTDDERKGNTGVAIDVLREVGNKLCEYP
KDFAINSKIARQLEAKKKSLETGEGIDWATAEALAYGTLLVEGNGVRLSGQDSGRGTFSH
RHAVMYDQNTENKYIPLNHLRPDQGPFEVHDSPLSEAAVVGFEYGYSLAEPHSLTLWEAQ
FGDFANTAQTIIDQFLSSGESKWLRMSGLVLLLPHGYEGQGPEHSSARPERFLQMSAEDN
WQICNLTTPANLFHAFRRQMRRPFRKPLVLFTPKSLLRHKLCVSSLSELAEGTNFRRVLG
ETATDLLPNEQIRRIVVCTGKVYYDLLQERTARGIKDVALVRLEQLYPFPRSALTEEFAR
YPNAEVVWCQEEPENQGYWAFVDRRLEGALTSIEHKASRPSYAGRPAAASPATGLLKRHN
QEQAKLLEDALVIR
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctaatctggagaagacctcgttcctgttcggctcgaacgccgaatatgtcgcg
gagttgtacgcgcgcttcctgaaggacccctcctcggtggattcgagctggaacggcttc
ttcagggagctggacgacgactcccgcgccgtcctgaacgagctgaacggcccgtcctgg
agtcttgaggagggcacgctcgccaacggcgcgctcgaccccgtcgccgcctcgctggac
agcatcggcgccccggccgcgaccaacggcaacgccggcctcgtcgcccacgcccagcag
gtctatggcggcatcagccaccagcagctgcgcgccgcgacgctcgacagcatccgcgcg
ctgatgctcatccgcgtctaccgcgtgcgcggccacatgaacgcgcatttcgacccgctg
ggtctcgagaagcgcgagccgcaccccgagctggacccggcgacctacggcttcggcccg
ggcgacatggaccgcccgatcttcctgaactactcgctgggcctggagacggcgtcgctg
cgccagatcctggagatcctgcagaagacctactgcgggaacatcggcgtcgagttcatg
cacatccaggaccccgaagagaaggcctggatccaggagcgcatcgagggcgggcgcaac
cacaccgaattcacggtgaacggcaagcgcgccatctacgagcggctgatcgccgccgag
ggcttcgagaagttcctgcagctgaagtacaccggcaccaagcgcttcggccttgagggc
ggcgagtcgatgatccccgcgctggagcaggttctcaagcgcggcggccagctcggcctg
aaggaggtcgtcgtcggcatggcccaccgcggccggctgaacatgctgaccaacttcatg
ggcaagcccttcgccgcggtcttctcggagttccagggcaacccgtccagcccgcaggac
gtgcagggctcgggcgacgtgaagtaccatctcggcacctcgtcggaccgcgacttcaac
ggcaacatcgtccacctgtcgctgaccgccaacccgtcccacctggaatgggtgaacccg
gtcgtgctgggcaaggtgcgcgccaagcaggcgcagcgcaacgacctggaccgcgagcag
gtcatgggcgtgctgatccacggcgacgccgccttcgccggccagggcatcgtggccgag
acgctgggcctgtcggagctgcgcggctaccgcaccggcggcaccgtgcacttcatcatc
aacaaccagatcggcttcaccacgaacccgacctattcgcggtccggcgtctactgctcg
gacatggcgaagatggttcaggcgccgatcttccacgtcaacggcgacgaccccgagtcc
gtcgtccacatcagccgcatcgccgccgagttccgccagaagttcaagcgggacgtggtg
atcgacatggtctgctaccgccgccacggccacaacgagggcgacgagccgggcttcacc
cagccgctgatgtacaagaagatccgcgcccacgcgaccacgcgggagctgtacggcaag
cagctcgtcgaggagaacgtcctcacccaggccgagtccgatcagatgatccaggacttc
atgaagaagctggagggtgagttcgaggccgccaactccttcaagccgaacaaggccgac
tggctggaaggcaagtggtcgggcctggaggccgcgaagaccgacgacgagcgcaagggc
aacaccggcgtggcgatcgacgtgctgcgcgaggtcggcaacaagctctgcgagtacccg
aaggacttcgcgatcaactcgaagatcgcccgccagctcgaagccaagaagaagtcgctg
gagaccggcgagggcatcgactgggcgacggcggaagcgctcgcctacggcacgctgctg
gtcgagggcaacggcgtccgcttgtcgggccaggactcgggccgcggcaccttctcgcac
cgccacgcggtgatgtacgaccagaacaccgagaacaagtacatcccgctgaaccacctg
cgccccgaccagggcccgttcgaggtgcatgacagcccgctgtccgaggccgccgtggtc
ggcttcgaatacggctactcgctggccgagccgcacagcctgaccctgtgggaggcgcag
ttcggcgacttcgccaacaccgcccagaccatcatcgaccagttcctctcgtcgggcgag
tcgaagtggctgcgcatgtccggcctcgtgcttctgctgccgcacggctacgagggccag
ggcccggagcactcctcggcccgtccggagcgcttcctccagatgtccgccgaggacaac
tggcagatctgcaacctgacgaccccggcgaacctgttccacgccttccgccgccagatg
cgccggcccttccgcaagccgctggtgctgttcacgccgaagtcgctgctgcgccacaag
ctgtgcgtctccagcctgtcggagctggccgagggcacgaacttccgccgcgtgctgggc
gagacggcgaccgacctgctgccgaacgagcagatccgccgcatcgtcgtctgcactggc
aaggtctattacgacctgctgcaggagcgcaccgcgcgcggcatcaaggacgtggcgttg
gtccggctggagcagctctacccgttcccccgctccgccctgaccgaggagttcgcccgc
tatccgaacgccgaggtcgtgtggtgccaggaggagccggagaaccagggttactgggcc
ttcgtcgaccgccgtctggaaggcgccctcacctcgatcgagcacaaggcctcgcgcccc
agctacgccggccgcccggccgccgcgtcgccggccaccggcctgctcaagcgtcacaac
caggagcaggcgaagcttctggaagacgcgctcgtcatccgctga

DBGET integrated database retrieval system