KEGG   Acinetobacter baumannii SDF: ABSDF0117Help
Entry
ABSDF0117         CDS       T00660                                 

Gene name
dadX
Definition
(GenBank) alanine racemase 2, PLP-binding, catabolic
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
abm  Acinetobacter baumannii SDF
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABSDF0117 (dadX)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ABSDF0117 (dadX)
Enzymes [BR:abm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ABSDF0117 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:abm01011]
 Precursor biosynthesis
  Racemase
   ABSDF0117 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
117972..119075
Genome map
AA seq 367 aa AA seqDB search
MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIERVYEAFKAADGFALLD
LEEAKRIRALGWTGPILLLEGVFSPQDLFDCVQYQLSFTIHSEAQIEWVEQHPYPAQFDV
FLKMNSGMSRLGFKPQHYVQAWERLNNLANVAKITHMMHFSDADGDRFGQQGIDYQITAF
EEIVKDLPGERSVSNSAAILRYQDQLKSDYVRSGIMLYGSSPDYPTHSIADWGLQPTMSL
RSEIISVQHLEPNESVGYGSNFVAEQPMTIGIVACGYADGYQRISPTGTPVLVDSVRTRT
VGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTGVVLPIDDVAVSSGTVGYELMCAVTAR
VQFINQV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctattaccgcagtgatccaccgtcaagccttacaaaataacttggcggtg
gtgcgcaaggctatgccaaatagtaaggtctttgccgttgtcaaagccaatgcttatgga
cacggaattgaacgtgtttatgaagcatttaaagcagcagatggctttgccttacttgat
cttgaagaagcaaaacgaattcgtgctctaggctggacaggtccaattttattgctcgaa
ggagttttctctcctcaagatttatttgattgtgtgcagtatcagcttagtttcaccatt
catagtgaagcgcaaattgagtgggtagaacagcatccttatccggctcaatttgatgtt
ttcttgaaaatgaacagtggtatgagccgtcttggttttaaaccacagcattatgtgcag
gcttgggaacgtttaaataatttggcaaatgtcgccaagattacccacatgatgcatttt
tcggatgcagatggcgatcgtttcggtcagcaaggtattgattatcaaattactgccttt
gaagaaattgtgaaggatttaccgggtgaaagatcggtaagcaatagtgcggcaattctg
cgttatcaagaccagctcaaatcagattatgtccgtagcggcatcatgctttatggcagc
tcgccagattacccaacccatagtattgcggactggggcttgcagccgaccatgagctta
cgtagtgaaattatttccgttcagcatttggagccgaatgaaagtgtaggttatggctca
aactttgtcgcagagcaacccatgacgattgggattgtggcttgcggctatgccgatggt
tatcaacgtatttcgccaacaggtactccagttttagtggactcagtacgcacacgtaca
gttggccgcgtcagtatggatatgttggcagtcgatttaacgggtattgagagtgccaaa
gttggtagtgaagtggtgctctggggtcagtcaagtacaggcgtcgttctacctattgac
gatgttgcagtttcatccggtacggtgggttatgaactgatgtgtgccgtcaccgcccgt
gttcaatttattaatcaggtataa

DBGET integrated database retrieval system