KEGG   Acinetobacter baumannii AB0057: AB57_2921Help
Entry
AB57_2921         CDS       T00793                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AB57_2921
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AB57_2921
Enzymes [BR:abn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AB57_2921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3018477..3020714)
Genome map
AA seq 745 aa AA seqDB search
MAGEKSTIIYTLTDEAPLLATYSLLPIIETFTKPAGIEIVKSDISVAARVLAEFADYLSE
EQKVSDNLAELGRLTQDPDTNIIKLPNISASVAQLTACIKELQSKGYAIPDYPENPATEE
EKTIKARYGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMSEWKQWSQTHVSHMEE
GDFYHGEKSMTLDRPRNVKMELITNSGKSIVLKPKVALQEGEIIDSMFMSKKALCDFYEK
QLDDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMA
GLYEKIETLPTSLREEIIEDLHACQEHRPALAMVDSAKGITNFHSPNDIIVDASMPAMIR
AGGKMWGADGKQYDAKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIPEAGIANITDFDTGEVLLTQNVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHENELIKKVQKYLKDHDTTGLDIQIMSQVRAMRYTLERVVRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEEMGIKENNARAKLLAKTLDEATGKLLDNDKSPSRRTGELDNR
GSHFYLSLYWAEALAAQNEDAELKAKFAPLAKALAENEQKIVAELAQVQGKPADIGGYYA
VDPAKVSAVMRPSATFNAALSTVQA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgaaaagtcaaccatcatttacacactgactgacgaggcgccattattggcg
acttattcgctactgccgatcattgagacctttactaagccagctggtatcgagattgtt
aaaagtgacatctctgtagctgcacgtgtgctcgcagaattcgctgactacctaagtgaa
gagcaaaaggtatccgacaaccttgctgagctaggtcgtcttacacaagatccagatact
aacattatcaaactcccaaatattagtgcctctgttgcgcaattgacagcatgtattaaa
gaacttcaatctaaaggttatgcaattcctgactatccggaaaacccagcgactgaagaa
gaaaaaacaatcaaagctcgttatggcaaatgcctaggttcagcagtaaaccctgttctt
cgtgaaggtaactctgaccgtcgtgctcctgctgccgttaaaaattacgctaagaaacac
cctcactcaatgagcgagtggaaacaatggtcgcaaactcacgtttcacacatggaagaa
ggtgacttctaccacggtgaaaagtcaatgacacttgaccgtccacgcaatgtaaaaatg
gaacttatcacaaacagtggtaagagcattgttcttaagccaaaagttgcgcttcaagaa
ggcgaaatcattgactcaatgtttatgagcaaaaaagcgctttgcgacttctacgagaaa
caacttgatgactgccgcgaagcaggaattttattctcattacacgtaaaagcgacaatg
atgaaagtttcacacccgatcgttttcggtcattgtgtgaaaatctactataaagaagct
ttcgaaaaacacggtaagttgtttgacgaattaggtattaacgtaaataacggtatggct
gggttatacgagaaaatcgaaactcttccaacctcattacgtgaagaaatcattgaagat
ttacatgcttgccaagaacaccgtcctgcacttgcgatggttgattcagcaaaaggtatc
actaacttccattcacctaatgacatcatcgtagatgcttctatgcctgcaatgatccgt
gctggtggtaaaatgtggggtgctgatggtaagcaatacgatgctaaggcagtaatgcca
gaatcaacatttgcccgtatttaccaagaaatgatcaatttctgtaaatggcatggtaac
tttgatccaaaaacaatgggtacagtaccaaacgttggtttgatggctcaaaaagctgaa
gaatacggttctcacgacaagacttttgaaattcctgaagcaggtattgcaaacattact
gattttgacactggtgaagtgttattgactcaaaatgttgaagaaggcgatatctggcgt
atgtgtcaggtgaaagacgctccgattcgtgactgggtaaaacttgcagtaactcgtgca
cgtaactcaggcatgcctgcgatcttctggcttgacccataccgtccacacgaaaatgaa
ttaatcaagaaagtacagaagtacttaaaagatcacgatacgactggtcttgatatccag
attatgtctcaagtacgtgcaatgcgttacacacttgagcgtgtagttcgtggcctcgat
acaatttctgtaaccggtaacatcttacgcgactacttaactgacttgttcccaattatg
gaacttggtacttctgcaaaaatgttgtctatcgttccgcttatggcgggtggtggcatg
tacgaaactggtgcgggtggttcagcacctaaacacgtacaacaacttgttgaagaaaac
cacttacgttgggattcgcttggtgagttccttgcgcttgcagtttctctagaagaaatg
ggtattaaagaaaataatgctcgtgcgaagttacttgcgaagacacttgatgaagcgact
ggtaaattgcttgacaatgacaagtctccatcacgtcgtacaggcgaacttgacaatcgt
ggcagccacttctacttgtcactttactgggcagaagcacttgctgcacagaacgaagat
gctgagttgaaagctaaatttgctccacttgcaaaagcattagctgaaaacgaacagaag
atcgttgctgagcttgctcaagtacaaggtaaaccagctgatatcggtggttactatgca
gttgacccagcgaaagtaagcgctgtaatgcgtccaagtgctacatttaatgcagcgctt
tcaactgttcaggcttaa

DBGET integrated database retrieval system