KEGG   Alcanivorax borkumensis: ABO_1248Help
Entry
ABO_1248          CDS       T00380                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
abo  Alcanivorax borkumensis
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:abo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABO_1248 (mdh)
   00620 Pyruvate metabolism
    ABO_1248 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    ABO_1248 (mdh)
  Energy metabolism
   00680 Methane metabolism
    ABO_1248 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ABO_1248 (mdh)
Enzymes [BR:abo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     ABO_1248 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1422348..1423334)
Genome map
AA seq 328 aa AA seqDB search
MFMKAPVRVAVTGAAGQISYSLLFRIASGDMLGKDQPVILQLLEITPALEALNGVIMELE
DCAFPLVAGITGTDDANVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQGKAIND
NASKGIKVLVVGNPANTNALIAQRNAPDIDPRQFTAMTRLDHNRAMAQLANKLGKTVNDV
KKMLIWGNHSSTQYPDLHHCEVDGKVAIDQVEQDWYENDYIPTVQQRGAAIIKARGASSA
ASAANAAVDHMRSWALGTDEGDWVSMGIYSDGSYGIQEGLIYSFPCTCKNGDWTIVQGLE
VNDFSRGKMQATEQELAEERDAVSHLLP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgttcatgaaagcacccgtacgcgtagccgtcaccggcgccgctggccaaatcagctat
tccctgctgttccgcatcgcttccggcgacatgcttggcaaagaccagcccgttattctg
caattgctcgaaatcacccctgctctggaagccctgaacggggtcatcatggagctggaa
gattgcgcattcccgctggttgccggtatcaccggtaccgacgatgccaacgtggccttc
aaagacgccgactacgcgctgttggttggtgctcgtccgcgtggtccgggcatggagcgt
aaagatctgctggaagctaacgcagccatcttctccgcccaaggcaaagccatcaacgac
aatgccagcaaaggcatcaaggttcttgttgtcggcaacccggccaacaccaatgccctg
atcgcccaacgcaacgcgcctgacatcgatccccgtcagtttactgccatgacccgccta
gaccacaaccgtgccatggcgcaactggccaacaaattgggcaaaaccgtcaatgacgtg
aagaagatgctcatctggggcaaccactcttccactcagtatcctgatctgcatcactgt
gaagtggatggcaaagtagccattgatcaggtcgagcaagactggtatgaaaacgactac
atcccgactgtacagcagcgtggtgcagcgatcattaaggcccgtggcgcgtcttctgcc
gcgtctgctgctaacgctgccgtggaccacatgcgttcctgggcactgggcaccgacgaa
ggtgactgggtttccatgggcatctacagtgatggttcctacggcattcaggaaggcctg
atctactccttcccttgcacctgcaagaatggcgactggactatcgttcagggcctagag
gtcaatgacttctcccgtggcaaaatgcaagccaccgagcaggaactggccgaagaacgt
gatgctgtttctcacctgctgccgtaa

DBGET integrated database retrieval system