KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT70360Help
Entry
AGABI1DRAFT70360  CDS       T03136                                 

Gene name
AGABI1DRAFT_70360
Definition
(RefSeq) hypothetical protein
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:abp00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AGABI1DRAFT70360 (AGABI1DRAFT_70360)
Enzymes [BR:abp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AGABI1DRAFT70360 (AGABI1DRAFT_70360)
DNA repair and recombination proteins [BR:abp03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     AGABI1DRAFT70360 (AGABI1DRAFT_70360)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1918 aa AA seqDB search
MQPTPAPSIPPQFDSNVPEYLPPPQNVDSAPFAVLAGLFEKLSTERKQDRRKKLLDAWFT
HWRREKGYDLYPVLRLLLPQKDRERAVYGLKEKNLAKTYIKLIPLGMRDPDAIRMLNWKR
PTEREKSSGDFPAVLYEVISKRSSVIEGSLSVDELNNILDELAQNMGKQDVQSKILQRIY
NKSTAEEQRWIIRIILKDMQISVKETTVFSVFHPDAQDLYNTCSDLKRVACELWDPSFRL
NVQDKMVQLFHTFAPMLSKRPTRKLEDTVREMGGLEFIIEEKLDGERMQLHKRGNEYYYS
SRKGKDYTYLYGKHVGTGSLTPHIDKAFDSRVDDIILDGEMLVWDPVTERNLPFGTLKTA
ALDKTQADINPRPCFKVFDLLYLNGQSLIHKPLTFRKRNLKHCITQVKGRIECVAEFKGT
TAKDIRERMEEVMAARGEGLIIKHPLSKYTLNGRIMDWIKVKPEYMDNMGETVDLLVVAG
NYGTGKRGGGVSTLICAVFEDRGIDEDDDEPKYSTFVRIGSGLSYADYVWIRAKPWKVWN
EQQNPSFLLTEKHSHEDKGDLFLEPEDSFIVKIKAAEIVPSDQYYMGFTMRFPRAMSIRD
DLTIADCMTASAVLEGMKTERKRKMESDITGLHPKRSAKKRKKATIIPQYQGPNLKNVSI
ESNIFDGMKFVVMSDPKSRSGDRVRRDLMKLIHANGGMCAQIVKPETFVIYGGTVMPYDL
KLVVQKNINDVIKPSWIKDSISLGEIAPFHHKYFFHATPGRKHEIDYDEGGEEETMEEDT
SEAVGFSDNAEAMRVESRETSEQKESDLEDLDPDLAEWFRGGKASDGGVARGVESETEAE
SDNDSDNVDVADEEGDEFKDDWELVKSGEHTTDSEDVQDVKMGETDEAMAYDENLIFKHL
CFYLDSPMNARRNEMEVKSKHEEAITGRKKRLEKIAELIIANGGKIVGLHEDKLTHVVLD
KRDITRRIELIKATSQPKRRHLVICEFIEACIEENTLLDEDVRVSNVYEMSGEGDETLGE
NVGVDPYPDVPCRAMANPQVSPISQLLLTLGITREDLSKRSDQMRQFLNPEQTTPSRVVD
RDAHHRSRSNSDLPSRLRSSSTSSSIARSISRNSSTSFRDSTPPITPIKSEVFDNGVPAR
QYNSMELVIERQRRQNKKERRTRKERERELSRNAPNPPSPSPSNTSSQPSVSLDSFMQSR
DGGRALLADDEDGALPIITPKQSIAPVTPQKSKYYREHTEFNSTSRPGEEITRKIETPTS
ARMLSASNPQSISHHQYYPYSAYGSYVSFSQDAGASTSTLPVTPQAKRTHLKVFKSPLPP
SSPPPSSPPSSPSCAINLVSSPGPIGPAPQEEEYDNLPYTLPPGPYSTNKPDLSYAALVG
QAILSSPEHRLTLQEIYDWITIVYPYFKRGETTWMNSIRHVLSTTVCFRKVPRDRSVGRT
QWAIWDEDLECFKGGNFRKHLCKDYMKQAAAKDKQTKGKSRVRKRTDTDDADLRKSKRPR
KDQVSSPLVASVNSQYPASFAPLFPPTRPTPHHQPYYQSCLSQTPNLPADIIFPPLPAAS
AFNRVLNRRNENAPQSSASSSTSSNRAISPPQTISSSSYGTPTSSASSVPGLTPNRQSSS
SPSMPATSDMDVEGANSVCTVAGADSQQGESEQIDGDDVLPLSGGTTLKPVRFWSEPNKS
NALEPGIKLLDSSHVVPEDEDSLLKSKKESQRAVSATQFPPFLLYPTSPTPERRAVDTIP
PVSNAEAGPSNQPRTPTPSTPPSGHTNLSSFHTPLSHKGLHMSPTASLAHYKTNLEPPPV
IPFDSEGESDPLRTPRKRKTSLDGLLGNPTTPRKMFNPNAIDSPYRTPNGFQASPFSRTP
RARPILDPQDPRTLLDDELNRMGTLSDSPGGLFGKSRSSLLYDSPGALDLPGKYRTWW
NT seq 5757 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaacaccggccccttcaattccacctcaatttgattcaaacgtaccagaatat
ctaccgcccccgcagaatgttgacagcgccccgtttgctgtcctcgctggtttgtttgag
aagctttccacagaaagaaagcaagatagaagaaaaaagttgctcgacgcttggttcact
cactggagacgtgaaaaaggatacgacctctatcccgtcttgcgacttctcttgcctcag
aaggatcgagaacgcgcagtttacggtttgaaggagaagaatctcgcgaaaacatatatc
aaactgatccccttgggtatgagggacccagatgccatccgcatgttgaactggaaaagg
ccaacagaacgcgagaaatcgtctggggactttcctgccgtgctttatgaggtcatcagt
aagcgatcctctgtgatcgagggttccttgtctgtcgacgagctcaacaacattctcgat
gagcttgcacaaaacatgggaaaacaagatgtccagtcgaagatcttacagcgtatctac
aataagtctacagcagaagaacagcgatggataatccgcatcattcttaaggacatgcaa
atatcggttaaagaaaccactgtattttccgttttccacccagacgctcaggacctctat
aacacctgctcagatcttaagagagtggcatgcgagttgtgggacccttcctttcggttg
aacgttcaggacaaaatggtacaattgtttcatacgtttgctcccatgttaagcaaacgt
ccaactcgaaagctcgaagatacagttcgagagatgggcggtttagagtttatcatcgag
gagaaactcgatggggagcggatgcaacttcataagcgaggcaacgaatactactattct
tctaggaagggaaaagattatacctatctttatggtaaacacgtcggtacaggtagcctg
accccccatatcgacaaagctttcgacagtcgcgttgacgacatcattttggatggagaa
atgctcgtttgggacccagtgacggaacgcaacctgccttttgggacactcaagacagcg
gcgttagacaagacgcaagcggatattaacccacggccctgctttaaagtttttgatctc
ctttacctcaatggccagtctctgatccacaaacctctcactttccggaaacgcaatctt
aaacattgcatcactcaggtgaagggtcgcatcgaatgcgtcgccgagttcaagggaact
acggctaaggacatcagggaacggatggaagaggtcatggctgccaggggtgaaggactg
atcataaagcatcctttgtcgaaatatactttgaatggtaggatcatggattggattaag
gttaaaccagaatacatggacaacatgggtgaaaccgttgacctgctcgttgtcgctgga
aactatggtactgggaaacgcggtggaggtgtatccactctcatatgtgctgttttcgaa
gatcgtggaattgacgaagacgacgacgaacccaaatacagtacctttgttaggattggt
tccggactatcgtatgccgactatgtttggattcgtgccaaaccatggaaagtatggaat
gagcagcaaaatccttcatttctactaacggagaagcattctcatgaggacaaaggagat
ctgttcttggagcctgaggactcatttatcgtgaagattaaggcagcggagatcgttccg
tcagatcaatattacatgggcttcacgatgcgatttcctcgagcgatgagcattcgtgat
gatcttactatcgcggactgtatgaccgcatcagctgtactggaaggcatgaagactgag
cgaaagcgcaaaatggagagtgacattactgggcttcatcccaagaggtccgcgaagaag
cgtaagaaggctaccataatccctcagtatcaaggaccgaatctcaagaacgtttctatc
gaatccaatatctttgatggaatgaagttcgtggtgatgtccgatcccaagtcacggtct
ggtgaccgagtccgcagagacttaatgaaactgatacatgccaacggaggtatgtgtgcg
cagatcgttaagcccgaaacgtttgttatttatggtgggactgttatgccgtatgatttg
aagttggtggtacagaagaatattaacgacgtgatcaaaccctcgtggattaaagattcg
atatcgctcggagagatagctccgtttcatcacaagtattttttccatgccacacctgga
aggaagcatgaaattgattacgatgagggcggagaagaggaaacgatggaagaagacacg
tcggaggcggtcgggtttagcgacaatgctgaagcaatgcgggtggaatcaagggagaca
tctgagcaaaaggaaagcgatctagaagatttagaccctgatttggcagaatggtttagg
ggaggaaaggcttccgatggcggggtagctaggggggtcgagtctgaaaccgaagcggag
agtgacaatgactcagacaacgttgatgtagcggatgaagagggagatgagtttaaagat
gactgggaattggtgaagagcggggaacatacgacggattccgaggatgtgcaggatgtg
aaaatgggcgagacggatgaggctatggcctatgatgagaatctgatattcaaacacctg
tgtttctaccttgattccccgatgaacgcgcgtcggaatgagatggaggtgaagagtaaa
cacgaagaagctatcacaggaagaaaaaaaaggctggaaaagatagctgaactcatcatc
gcaaatggtggcaagattgttggtcttcacgaagacaaactgacgcacgtcgtacttgac
aagcgagacataacgcggagaatcgagctgattaaagccacttctcagccgaaacggcgt
cacttggttatctgtgaattcatcgaggcttgtatagaggagaacactctactggatgag
gatgttcgtgtctccaacgtgtatgaaatgtctggtgaaggagatgagactttgggtgag
aatgtcggagttgatccgtacccggacgtgccgtgtcgagcgatggctaacccccaggtc
tctcccatctcccagctcctcctcactcttggcataacgcgtgaggacctcagcaaacgt
agtgaccagatgcgacagttcctcaatcctgaacaaaccaccccttcacgcgttgttgac
cgcgacgctcaccacaggtcgcgctccaactcagatttgccctcgagattaagatcttcc
agcacatcgtcgtccattgctcgttccatctcaagaaacagttctacttctttccgcgac
tccactccccccatcaccccaattaagtcggaagtgtttgacaacggcgtccccgcgagg
cagtacaattcaatggaactggttatcgagcgccaacgtagacaaaataaaaaagaaaga
agaactcgtaaagaaagggaacgcgagttgtcgagaaatgctccaaatccaccttcaccc
tcacccagcaacacgtcttcccaacctagtgttagtttggattcttttatgcaatcgcgc
gacggaggcagggcgcttctcgcagacgacgaggatggggcactgcccatcatcaccccc
aagcaatctatcgcgcctgtcacgcctcaaaagagtaaatattacagagaacataccgag
tttaattccaccagtcgcccgggagaggaaatcactcgaaaaattgagacacctaccagt
gcgagaatgctgtcagcctcgaatccgcaaagcatttctcatcatcaatattatccctac
tcagcctatggtagctatgtatctttcagccaggatgcgggagcttcaacttccaccctt
cccgtgacacctcaagctaagcgtacccacctgaaagtgttcaagtcaccgctacctccg
tcatcaccaccgccttcctcacctccttcttccccatcatgcgccataaatctggtttca
tctccgggcccaatcggcccggctcctcaagaggaagaatatgacaatttaccatacacc
ctcccaccaggcccgtactctacaaacaagccggacttatcatacgcggcgctcgtggga
caagccatcctatcatcgccagagcatcgtttaactttgcaggagatctatgattggatc
accatcgtgtatccgtattttaagcgtggggagacgacctggatgaacagcatccgtcac
gtcttaagtaccacggtgtgttttcgcaaagttccaagggatcgatctgttggtcgcact
caatgggctatatgggatgaagatctagagtgtttcaagggaggcaacttccggaagcat
ttgtgcaaagactatatgaaacaagctgctgccaaggataagcagaccaagggaaagtct
cgggtgcgaaagagaactgatactgatgatgccgaccttcgcaaatctaagcgccctcgc
aaggatcaagtctcatcccccttggtggcatcagttaacagtcaatatccggccagtttt
gctcccctcttcccccctacccgacctaccccacatcatcagccctattatcagtcatgc
ttgtctcaaactcctaatctcccggccgacatcatatttcctcctctccccgccgcgtcg
gctttcaatcgggttttgaataggcgtaacgagaacgcaccgcaatcttctgcaagcagt
tcaacctcttccaacagagccatttccccgccacagactatctcgagttcttcatacggg
acacccacttcctcggcgtcatctgtccctgggctcactcccaaccggcagtcttcaagt
tcaccgtcgatgcctgcgacaagcgacatggatgtggaaggtgcgaactccgtgtgtaca
gtcgcaggagcggattctcagcagggcgaatcggagcagattgacggcgatgatgtcctt
cctctgagtggcggcacgaccttgaagcctgtccgattttggagtgagccaaacaagagt
aatgcgctcgaacccggtatcaagcttctagattccagccacgtcgttcctgaagatgaa
gatagtctcctcaagtcaaagaaagagagtcaaagagctgtttctgcgactcaatttcca
cctttcctcttatacccaacatcacccactcctgaaaggagagcggtggatacgatccct
ccggtgtccaatgccgaggctggaccttccaaccaaccaaggactcccactccgtccacc
cctccctccggccatacaaatctttcatcttttcataccccactgtcgcataagggtcta
cacatgagtccaacagcgagtctggctcattacaagactaatttggagcctcctcctgtc
ataccgttcgacagcgaaggcgagtccgaccctctacgaacgccacgcaaacgcaaaacg
agcttggacggacttctaggcaatcctaccactccaaggaagatgttcaatcctaacgcc
atagattcgccgtatcggacgcccaatggattccaggcttcaccctttagccgaactcct
cgagcaagacctatactcgatccacaagatcctagaacattgcttgatgacgaactaaac
agaatgggaacactctcagacagtcctggagggctatttggcaagagtcgaagttcgttg
ttgtatgatagtccaggcgcgctggatttgcctggcaagtatcgaacttggtggtag

DBGET integrated database retrieval system