KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT82568Help
Entry
AGABI1DRAFT82568  CDS       T03136                                 

Gene name
AGABI1DRAFT_82568
Definition
(RefSeq) hypothetical protein
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AGABI1DRAFT82568 (AGABI1DRAFT_82568)
Enzymes [BR:abp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AGABI1DRAFT82568 (AGABI1DRAFT_82568)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 533 aa AA seqDB search
MLSLAISLSLFLLFSIARAATADQWRGRSIYQLITDRFALPNGTDPSACDPAERAYCGGT
WNTIRENLDYIQDAGFTAIWISPVNENYDGPRTVYGDAYHGYWIKDFSKLNNRFGTADDL
KALVAELHRREMYIMVDVVINNVMSTSLKPDYSQYFFEDSSMYHPYCPIQWGNTTSEQTC
WLGDTKVPLPDVNTSHPTVIAQYGDWIHDLVQEYQFDGLRIDAAKHVHVDFWPTFAAKAG
VFCMGEVFSGVEVDPVAQYQGPQGLDSVLNYPMYTALVEAFGIPGPGNITAVSTVIEQSQ
NSFHDTTVLGNFLENQDVPRWHNISVDPQSLYNAMVLNFMMDGIPVVYYGQEQSFSGSSD
PYNREPLWPSQYQQTDAYKFIQTLNQFRNYLVKTDWATQKTQILTASPYGIAVMKGKIIS
VVTNIGSPPRNGTDIAVKSPFESSSSMINILTCQQWVVGSRGYLDVQYTKGGQPVILAPA
DSLNDSGFCGNTLSTTVVGNSTRQNSAASSLHPWRLSAAALFIALTLHWAIKY
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgctttctctagccatctctctctccctctttctccttttcagcatcgcacgggccgca
actgcggaccaatggcgtggtcgttctatataccaactgattacagaccgctttgctctc
cccaatgggactgaccccagcgcttgtgacccagcagaacgagcatactgtggtgggaca
tggaatacgatacgcgaaaatcttgactacattcaggatgctggctttaccgccatatgg
atcagtcccgtgaatgaaaactatgatggtccccgtactgtgtatggtgacgcatatcac
ggctattggatcaaagacttcagtaagctcaacaatcgtttcggcacggccgatgatctc
aaggccctggttgcggagctccatcgtcgcgaaatgtatattatggttgatgttgtgatt
aacaacgtcatgtccacctcgttgaagcccgattattctcagtacttttttgaagactct
tccatgtatcatccctattgtccaatacaatggggtaatactaccagcgaacaaacttgt
tggttaggagacaccaaagtgcctcttcctgacgtcaacacgagtcatcccaccgttatt
gctcaatacggggactggatccatgatcttgttcaggagtaccaatttgatgggcttcgc
attgacgccgccaagcatgtacacgtcgatttttggcctacctttgctgccaaggccggg
gtattttgcatgggagaagtctttagtggagtcgaagttgaccctgttgcacaatatcaa
gggccccaaggacttgactccgttctcaactatcctatgtacacagctttggtagaggca
tttggcattcctgggcctggtaatataaccgcggtttcgactgtaattgagcagtctcaa
aacagttttcatgacaccaccgtcctaggtaattttctagaaaaccaggatgttccccgc
tggcataatatatctgttgatccccaaagcctatataatgccatggtcttgaatttcatg
atggatggcatccccgtcgtatattatggacaagaacaatctttctcgggtagctctgac
ccctacaaccgcgaacccctctggccgtctcagtaccagcaaactgacgcctataaattc
atccagaccctgaaccaatttcgcaactatctagtcaaaacagattgggcgacgcaaaag
actcagatattgactgcgagtccttatgggattgctgtaatgaaaggaaaaataatatct
gtcgttactaacatcggttcccccccacgaaacgggactgatatcgcggtgaagtctcct
tttgaatctagttcaagcatgattaacattttgacttgccaacaatgggtcgtgggatcg
agaggctatcttgacgtccaatataccaaggggggtcagcccgtcattcttgcgccagct
gattcactcaatgactctggcttctgtggcaacacgctcagtactacagttgtggggaat
tctactcgccagaactctgctgcatcttcactccacccgtggcgtttatccgccgccgct
ctgttcattgcgttgactttacattgggctatcaaatattga

DBGET integrated database retrieval system