KEGG   Azospirillum brasilense Az39: ABAZ39_31205Help
Entry
ABAZ39_31205      CDS       T03288                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
abq  Azospirillum brasilense Az39
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:abq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABAZ39_31205
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ABAZ39_31205
   00680 Methane metabolism
    ABAZ39_31205
Enzymes [BR:abq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ABAZ39_31205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
AbAZ39_p4:complement(276590..279409)
Genome map
AA seq 939 aa AA seqDB search
MTTDAALHSNAPVSDTETGTDTGTDDKDFPLREDIRLLGRLLGDTVREQEGDSVYGVIES
VRQASVRFNRDDDDSARREMAEILNGLPRDTMMSVVRAFSYFLHLANIAEDQHHIRRTRD
HAIAGSPAREGTLPYALERLEAAGVAPDRLAGVLDIAQVSPVLTAHPTEVQRKSILALEH
KVASLLDTRDRSRLTPEEAEANMDALQEAILTLWRTRMLRPQRLAVIDEVKNGISYYTDT
FFSELPKLFCRFEDLLAKRFPDRQWSLPPYFRIGSWIGGDRDGNPFVTAPILREAMRLQS
TAALDHYLTEIHELGGELPLSELLLGTSPELEELAKRSPDHSPHRADEPFRRALTGIYAR
LAATSRTLDQHEALRNAVGKGDPYPTSAELLADLEVLAASLKAHGAGRLAAGRLRRLIIA
VKTFGFHLAPIDLRQNSDVHQRTVAELLAVAGRCADYAALSEDERIALLAEEIQSPRPLH
SPYHAYSEETAGELAIFFAARQLRETYGPAALPNSIISKTDGASDLLEVALLLKESGLLR
PGAGGEPALGLNIVPLFETIEDLRQAPATMERLFTLPAYRALVTSRGDEQEVMLGYSDSN
KDGGFLTSGWELYKAEIELAKLFDRHGVRMRLFHGRGGSVGRGGGPSYQAILAQPTGAVS
GQIRITEQGEVIASKYGRPEVGQRNLEVLTAATLEATLLDLENRVEPAEAFYAAMERLSE
LAFGAYRGLVYETPGFTQYFRTATPISEIATLNIGSRPASRTKSDRIEDLRAIPWVFSWA
QCRLMLPGWYGFGSAVEAWLKEEPDGLALLQRMNRAWPFFKSLLSNMDMVLAKSDLAIAS
RYAELVEDVELRERIFGRIREEWQRTRRHLLAIAGHDELLGENPLLARSIRNRFPYMDPL
NHVQVELLRRHRAGSSDERVRRGILMSINGVAAGLRNSG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacgccgccctccattccaacgctccggtcagcgacaccgaaaccggcacc
gacactggcaccgacgacaaggatttcccgctgcgcgaggacatccgcctgctcggccgc
ctgctcggcgacacggtgcgcgagcaggaaggcgacagcgtctacggcgtcatcgagagc
gtgcgccaggcgtcggtgcgcttcaaccgcgacgacgacgattccgcccgccgcgagatg
gccgagatcctgaacggcctgccgcgcgacacgatgatgtcggtggtgcgcgccttctcc
tacttcctgcacctcgccaacatcgccgaggaccagcaccacatccggcgcacccgcgac
cacgccatcgccggctcgccggcgcgcgaaggcaccctgccatacgcgctggagcggctg
gaggccgccggcgtcgccccggaccggctggccggcgtgctggacatcgcacaggtcagc
ccggtgctgaccgcccacccgaccgaggtccagcgcaagagcatcctggcgctggagcac
aaggtggcgtccctgctcgacacccgcgaccgttcgcgcctgacgccggaggaggcggag
gccaacatggacgcgctccaggaggccatcctgaccctgtggcgcacccgcatgctgcgc
ccgcagcgcctcgccgtgatcgacgaggtgaagaacggtatttcctactacaccgacacc
ttcttctccgagttgccgaagctgttctgccgcttcgaggatctgctggccaagcgcttc
cccgaccggcagtggtcgctgccgccctatttccgcatcggttcctggatcggcggcgac
cgcgacggcaaccccttcgtcacggcaccgatcctgcgcgaggcgatgcgcctgcaatcg
accgccgcgctcgaccactatctgaccgaaatccacgagttgggcggcgagctgccgctg
tccgagctgctgctcggcacctcgccggaactggaggagctggccaagcgctcgcccgac
cattcgccgcaccgcgccgacgagccgttccgccgcgccctgaccggcatctacgcccgt
ctggcggcgacctcgcgcacgctcgaccagcatgaggcgctgcgcaacgcggtcggcaaa
ggcgatccctacccgaccagcgccgaactgctggccgacctggaggtgctggccgcctcg
ctgaaggcccacggggcggggcgtctggccgccgggcggctgcgccgcctgatcatcgcg
gtgaagaccttcggcttccatctggcgcccatcgacctgcgccagaactccgacgtgcac
cagcgcacggtggcggagctgctggccgtggccgggcgctgcgccgactacgccgccctg
tcggaggacgagcgcatcgccctgctggccgaggaaatccagagcccgcgcccgctccat
tcgccctaccacgcctattcggaggagacggcgggcgagctggcgatcttcttcgccgcc
cgccagctccgcgagacctacggacccgccgccctgccgaacagcatcatctccaagacg
gacggcgcgtccgacctgctggaggtggcgctgctgctcaaggaatccggcctgctgcgt
cccggtgcgggcggcgagccggcgctcggcctcaacatcgtcccgctgttcgagaccatc
gaggatctccggcaggccccggcgaccatggagcggctgttcaccctgcccgcctaccgc
gccctggtcacctcgcgtggggacgagcaggaggtgatgctcggctattcggacagcaac
aaggacggcggtttcctgacctccggctgggagctgtacaaggcggagatcgagctggcg
aagctgttcgaccgccacggcgtgcgcatgcggctgttccacggccgcggcggctcggtc
ggccgcggcggcggccccagctatcaggcgatcctggcccagccgaccggcgcggtgtcc
ggccagatccgcatcaccgagcagggcgaggtcatcgcgtcgaagtacgggcgccccgag
gtcgggcagcgcaacctggaggtcctgaccgcggcgacgctggaggccaccctgctcgac
ctggagaaccgcgtcgagccggcggaagccttctacgcggcgatggagcggctgtcggag
ctggccttcggcgcctatcgcgggctggtctatgagacgccgggcttcacccagtatttc
cgcacggccacgccgatctcggaaatcgccacgctgaacatcggcagccgcccagcctcg
cgcaccaagtcggaccgcatcgaggacctgcgcgccattccctgggtcttctcctgggcg
cagtgccgcctgatgctgccgggctggtacggcttcggcagcgccgtggaggcttggctg
aaggaggaaccggacgggctcgccctgctccagcgcatgaaccgcgcctggcccttcttc
aagtcgctgctgtccaacatggacatggtgctggccaagagcgatctcgccatcgcctcg
cgctacgcggagctggtggaggacgtcgagctgcgcgagcgcatcttcggccgcatccgc
gaggagtggcagcgcacccgccgccatctgctggccatcgccggccatgacgagctgctg
ggcgagaacccgctgctggcgcggtcgatccgcaaccgcttcccctacatggacccgctg
aaccatgtccaggtcgagcttctgcggcgccaccgcgccggcagcagcgacgagcgggtg
cggcgcggcatcctgatgtcgatcaacggcgtcgccgccggcctgcgcaacagcggctga

DBGET integrated database retrieval system