KEGG   Azospirillum brasilense Sp245: AZOBR_160001Help
Entry
AZOBR_160001      CDS       T02152                                 

Gene name
tufB1
Definition
(GenBank) elongation factor Tu (EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
abs  Azospirillum brasilense Sp245
Brite
Translation factors [BR:abs03012]
 Eukaryotic Type
  Elongation factors
   AZOBR_160001 (tufB1)
 Prokaryotic Type
   AZOBR_160001 (tufB1)
Mitochondrial biogenesis [BR:abs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AZOBR_160001 (tufB1)
Exosome [BR:abs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AZOBR_160001 (tufB1)
  Exosomal proteins of breast cancer cells
   AZOBR_160001 (tufB1)
  Exosomal proteins of colorectal cancer cells
   AZOBR_160001 (tufB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2401130..2402320)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAESGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDPELLELVEMEVRELLSSYQFPGDDIPIVKGSALCALE
DRSPEIGRDAILKLMAEVDQYIPQPERPKDRPFLMPIEDVFSISGRGTVVTGRVERGIVK
VGEEVEIVGLKTTVKTTVTGVEMFRKLLDSGEAGDNIGALLRGTKREDVERGQVLAKPGS
ITPHTTFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGMVKLPEGTEMVMPGDNIS
MEVELIAPIAMDEGLRFAIREGGRTVGAGVVASIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcaaagttcgagcggaacaagccgcactgcaacatcggcacgatcggccac
gtcgaccacggcaagacgtcgctgacggcggcgatcacgaaggtgctggccgagagcggc
ggcgcgaccttcaccgcctacgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatctcgacggcgcacgtcgagtacgagacgaccaaccgccactacgcccacgtc
gattgcccgggccacgccgactacgtgaagaacatgatcacgggcgccgcgcagatggac
ggcgcgatcctggtcgtgtcggccgccgacggcccgatgccgcagacccgcgagcacatc
cttctggcccgccaggtcggcgtgccggcgctggtggtgttcatgaacaaggtcgacatg
gtcgacgatccggagctgctcgagctggtcgagatggaggtgcgcgagctgctgtcctcc
taccagttcccgggcgacgacattccgatcgtcaagggctcggcgctgtgcgcgctggag
gaccgttcgccggagatcggccgtgacgcgatcctcaagctgatggccgaggtcgaccag
tacatcccgcagccggagcgtccgaaggaccgtccgttcctgatgccgatcgaggacgtg
ttctcgatctcgggccgcggcacggtggtgaccggccgcgtcgagcgtggcatcgtcaag
gtcggcgaggaagtcgagatcgtcggtctgaagaccacggtcaagacgacggtgaccggc
gtcgagatgttccgcaagctgctcgactcgggtgaggcgggcgacaacatcggcgcgctg
ctgcgcggcacgaagcgtgaggacgtcgagcgcggccaggtcctggccaagccgggcagc
atcacgccgcacaccaccttcaaggccgaggcctacatcctgacgaaggaagagggtggc
cgtcacacgccgttcttcaccaactaccgtccgcagttctacttccgcacgaccgacgtg
acgggcatggtgaagctgccggaaggcaccgagatggtgatgccgggcgacaacatctcc
atggaagtcgagctgatcgctccgatcgccatggacgagggcctgcgcttcgccatccgc
gagggtggccgcaccgtcggcgccggcgtcgtcgcctcgatcatcaagtaa

DBGET integrated database retrieval system